KEGG   Coprothermobacter proteolyticus: COPRO5265_0649Help
Entry
COPRO5265_0649    CDS       T00773                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cpo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    COPRO5265_0649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpo01007]
    COPRO5265_0649
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpo03016]
    COPRO5265_0649
   03029 Mitochondrial biogenesis [BR:cpo03029]
    COPRO5265_0649
Enzymes [BR:cpo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     COPRO5265_0649
Amino acid related enzymes [BR:cpo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   COPRO5265_0649
Transfer RNA biogenesis [BR:cpo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    COPRO5265_0649
 Prokaryotic Type
   Other AARSs
    COPRO5265_0649
Mitochondrial biogenesis [BR:cpo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    COPRO5265_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N DUF3477 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACI17331
UniProt: B5Y8A2
Position
591170..592750
Genome map
AA seq 526 aa AA seqDB search
MTDVIRTAITESTQKVFGLSTEDMPALDIQFTPDITMGDYAVPIGFVLAKKLRTAPEKIA
QTIAENLQGPFRAEAVKGYVNVTMDDDWWLDRLSQGFISYPQYSGKVLVEYVSANPTGPI
HIGHGRGAVVGSVLANLLDRVYDFADSEFYVNDAGEQIRKFCKSVEIRIRELKGEDVELP
EDAYHGDYVVDIAKSILDRYNWDALSEDEQWNVLWNDAVDMMRKWHKETLEKLGVTMKVW
TSERLIRQEGWPERVIQLLQDKGYAYEQDGALWFKSTIFGDDKDRVLVKSNGEYTYYLVD
IAYHMEKIHRGYNVLINVWGADHIGHVPRMNAALTALGFPDCLTVVLVQTVRFWRQGVAV
AMSKRKGEFLTLDELIDEIGKDAARIMFITRSVDATIDFDIEVAKQKAMDNPVYYIQYAY
VRAKNILTRTEERQFGSSVGFDPHERTLLRLLNAFQERMVLAVRKLDPFVIESYAWELSD
AFHKFYQFDRVIGSEYENARWKLVERFTEVMEELFTLLGIEKLERM
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgacagatgttatcagaacggctattactgagagtactcaaaaagtctttggtttgtct
acggaagacatgcctgcactggatatacaatttacgcctgacattaccatgggtgattat
gctgtgcccataggtttcgtgctggcaaagaagctaagaactgctcctgagaaaattgca
cagactattgcggaaaacctccagggtccatttcgggctgaagcagttaaaggctatgta
aacgtgaccatggacgatgattggtggttggatcgcctttcgcagggattcatttcctat
ccacagtattcgggtaaagtgctggtggagtatgtttccgcaaaccccactggtcctatt
cacattggacatggcagaggagcagtagtcggttcagtacttgcaaatttgcttgaccga
gtatatgactttgctgactctgaattctacgtaaacgacgctggtgagcaaataagaaag
ttctgcaaaagtgtggaaatcaggataagagagctaaagggcgaagatgtggaactgcca
gaagatgcataccatggtgactacgttgtggatattgcaaaaagcattttggaccgttac
aactgggatgcattgagtgaggacgaacagtggaatgtgctgtggaatgatgctgtggac
atgatgcgtaagtggcacaaggaaaccttggaaaagttgggtgtaaccatgaaggtgtgg
accagtgaaaggctcataagacaggaaggatggccagaaagggtcattcagttgctgcag
gacaaaggctacgcttacgaacaagatggagccttgtggttcaagtccaccatctttggt
gatgacaaagacagagtgcttgtgaagagtaatggggagtacacctactacttggtggac
attgcctatcacatggaaaaaatccaccggggctacaatgtactcataaacgtttgggga
gccgatcacataggacacgtgccacgcatgaacgctgctcttactgctttggggtttcct
gattgtttaacggtagtactggttcagacggtgaggttctggagacaaggcgtagctgtg
gctatgtcgaagcgtaagggcgagtttcttactctggatgaactcatagatgagataggg
aaagatgcagctcgaatcatgtttattaccagatcagtggatgccactattgactttgat
attgaggtggccaaacagaaagccatggataatccagtgtactacattcaatacgcttat
gttcgtgctaaaaacatattgacgcgaactgaggaacggcaattcggtagctcggttggt
tttgaccctcacgaaagaacactgcttaggcttctaaatgcttttcaagaacgcatggtt
ttagcagtgagaaaacttgatccatttgtcatagaaagctatgcttgggaattgtcagat
gcttttcataagttttaccagtttgatagagtaataggctcggaatatgagaatgcacgt
tggaagctggtggaacgattcacggaggtcatggaggaattgtttaccttgttgggtatt
gagaagttggagaggatgtaa

DBGET integrated database retrieval system