KEGG   Coprothermobacter proteolyticus: COPRO5265_0730Help
Entry
COPRO5265_0730    CDS       T00773                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00010  Glycolysis / Gluconeogenesis
cpo00051  Fructose and mannose metabolism
cpo00562  Inositol phosphate metabolism
cpo01100  Metabolic pathways
cpo01110  Biosynthesis of secondary metabolites
cpo01120  Microbial metabolism in diverse environments
cpo01130  Biosynthesis of antibiotics
cpo01200  Carbon metabolism
cpo01230  Biosynthesis of amino acids
Module
cpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0730
   00051 Fructose and mannose metabolism
    COPRO5265_0730
   00562 Inositol phosphate metabolism
    COPRO5265_0730
Enzymes [BR:cpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COPRO5265_0730
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COPRO5265_0730
  Exosomal proteins of bladder cancer cells
   COPRO5265_0730
  Exosomal proteins of melanoma cells
   COPRO5265_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NanE
Motif
Other DBs
NCBI-ProteinID: ACI17705
UniProt: B5Y8I1
Position
664356..665075
Genome map
AA seq 239 aa AA seqDB search
MRYVFGNWKMNGTLAFAEEYVNKLLGEVRPASVQVALFPPFTALSSFQYLVKDSFLKFGA
QNMYYEDSGAFTGEVSPVMLKEIGVDYVLIGHSERRHIFLENDEMLMKKVEAAHRHDIPV
VFCVGETLEERRTGATKDVLKRQLILVQDILSRGDIVAYEPVWAIGTGVTPTMDEIRESI
SWVKELLKADLPVLYGGSVNKGNAVDISEVSGVDGVLVGGASLKVEEFAIIIKAFDQNI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgagatacgtttttggcaactggaagatgaacggtaccttggcttttgccgaggagtac
gtaaacaaacttttgggagaagtgcggcctgcgtcagtgcaggtcgcactctttcctcct
tttactgctctaagcagttttcaatatcttgttaaagatagctttttgaaattcggtgct
caaaacatgtattacgaggattccggcgccttcacaggagaagtgtcacctgttatgtta
aaggagattggtgtggactatgtactcatcggtcactccgagaggcgtcacatttttctt
gagaatgatgagatgctaatgaagaaagttgaagcagctcacaggcatgatataccggta
gtgttttgcgtcggcgaaacacttgaggaaaggcgcactggagccactaaagatgttttg
aagcgtcaacttatcttggtacaggacattctaagcagaggagacattgttgcctatgag
cctgtatgggccataggaacgggcgtgaccccgaccatggacgaaattagggaaagtatc
tcctgggtgaaggaattattaaaagcagacttacctgttctttacgggggcagtgttaac
aaaggcaatgctgttgatatttccgaagtgtctggggtggatggagttttggtaggtgga
gctagcctaaaagttgaagaatttgctattataataaaagcgttcgaccagaatatttag

DBGET integrated database retrieval system