KEGG   Coprothermobacter proteolyticus: COPRO5265_1386Help
Entry
COPRO5265_1386    CDS       T00773                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00071  Fatty acid degradation
cpo00280  Valine, leucine and isoleucine degradation
cpo00380  Tryptophan metabolism
cpo00620  Pyruvate metabolism
cpo00630  Glyoxylate and dicarboxylate metabolism
cpo00640  Propanoate metabolism
cpo00650  Butanoate metabolism
cpo00900  Terpenoid backbone biosynthesis
cpo01100  Metabolic pathways
cpo01110  Biosynthesis of secondary metabolites
cpo01120  Microbial metabolism in diverse environments
cpo01130  Biosynthesis of antibiotics
cpo01200  Carbon metabolism
cpo01212  Fatty acid metabolism
cpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COPRO5265_1386
   00630 Glyoxylate and dicarboxylate metabolism
    COPRO5265_1386
   00640 Propanoate metabolism
    COPRO5265_1386
   00650 Butanoate metabolism
    COPRO5265_1386
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COPRO5265_1386
   00072 Synthesis and degradation of ketone bodies
    COPRO5265_1386
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COPRO5265_1386
   00310 Lysine degradation
    COPRO5265_1386
   00380 Tryptophan metabolism
    COPRO5265_1386
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COPRO5265_1386
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COPRO5265_1386
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    COPRO5265_1386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpo04147]
    COPRO5265_1386
Enzymes [BR:cpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     COPRO5265_1386
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COPRO5265_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACI17856
UniProt: B5Y608
Position
1253977..1255149
Genome map
AA seq 390 aa AA seqDB search
MNEVFISMPLRTAISKFGGSLKDIPAPEIAGKVINAILEETHLPPDAFDDVVLGNVIQAG
EKMNAARQAAIYGGISDSVPAMVVNRVCGSGLQAVITAAMEIQSGYASCVLAGGMENMDK
APYILSNGRYGARMGDTTLYDAMLMDGLNDAFTGKHSGLITDEYLVPKYGVTREEQDQFA
YESHMKAAKAIQEGKFSSQIVPIQVSKEFVFQVDENVRPDTTLERLAKLRPAFKEGGTIT
AGNAPSLNSGAAAMVLSTEKVANKFNLPVFGRILSCAVSAVDPNFFGIAPIPAVKNALEK
ASLSINDIDLFEINEAFAAIAIVVQRELSIPEEKLNVNGGAVALGHPIGASGAMLVTKIL
YELRNRQAKLGCVSLCIGGGQGIALIVERV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtttttataagtatgccgcttcgaacagctattagcaaatttggaggaagc
ttgaaagatataccggcacctgagattgcaggcaaagtcataaacgcaattcttgaagaa
acacatctaccgcctgacgcttttgatgacgttgtacttggtaacgtcatccaggctggg
gaaaaaatgaatgctgccagacaagccgccatttatggtggaataagtgactcggtaccc
gccatggtggtgaatagagtttgcggctccgggttgcaagctgtgataacggcagccatg
gaaatacaatctggctatgcctcttgcgttcttgcaggtggcatggaaaacatggataag
gcgccttacatcctctcaaacggaagatacggtgctcgtatgggcgacacaacactatat
gacgccatgctcatggatggactaaacgacgccttcactgggaagcactcaggtctaatt
accgatgagtatttagtccccaaatacggagtgaccagagaagaacaagatcaatttgca
tatgaaagtcacatgaaagccgccaaagccatacaagaaggtaagttctcctcacaaatt
gtcccgattcaggtatcaaaagaattcgttttccaggtagacgaaaatgtgcgccccgat
accacattagaaagacttgcgaaattaagaccggctttcaaagaaggtggcaccataacc
gcaggtaacgcaccatcactgaactctggggcagctgccatggtcttgtccactgaaaaa
gttgctaataagttcaacttgccggtctttggtaggattttgtcctgcgctgtttccgca
gtggaccccaatttcttcggcatagcacccatacctgccgtgaaaaacgcattagaaaaa
gcttctctttctattaatgatattgatctatttgaaataaacgaagctttcgcagccatt
gccattgtggtacaaagagagctaagtattcccgaagaaaaacttaacgtcaatggtggt
gcggtagctttaggccaccccattggagcgtcgggtgccatgctcgtcacaaaaatactt
tatgagctacgaaatcgccaagccaaacttggttgtgtttctctttgtatcggtggcgga
caaggaattgctctgattgtagagagagtctaa

DBGET integrated database retrieval system