KEGG   Cloacibacillus porcorum: BED41_03190Help
Entry
BED41_03190       CDS       T04453                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cpor  Cloacibacillus porcorum
Pathway
cpor00020  Citrate cycle (TCA cycle)
cpor00480  Glutathione metabolism
cpor01100  Metabolic pathways
cpor01110  Biosynthesis of secondary metabolites
cpor01120  Microbial metabolism in diverse environments
cpor01130  Biosynthesis of antibiotics
cpor01200  Carbon metabolism
cpor01210  2-Oxocarboxylic acid metabolism
cpor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BED41_03190
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BED41_03190
Enzymes [BR:cpor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BED41_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANZ44178
UniProt: A0A1B2I2H8
Position
710944..712149
Genome map
AA seq 401 aa AA seqDB search
MAKIQMTTPLVEMDGDEMTRIIWRQIKETLILPHVELKTEYYDLGLKHRDETDDQVTVDS
AEATKKYGVAVKCATITPNAQRVEEYGLKKQWKSPNGTIRALLDGTVFRAPIMVKGVRPT
VSTWKRPITIARHAYGDIYKDVEMNIPCAGTLKMIFEPADGDAGKRQEETVFEYKGPGVA
MGMHNLEKSISSFARACFKYALDTGQDLWFSTKDTISKKYDQTFKLIFEDIYEKEFRAEF
EKAGITYFYTLIDDAVARVVRSEGGFIWACKNYDGDVMSDMVATAFGSLAMMTSVLVSPD
GVYEYEAAHGTVTRHYYQHLEGKTTSTNPMATIFAWSGALRKRGELDGNAALQEFAGRLE
RASIETIESGEMTKDIFAISEVPNKKMLTTEEFLQSIAGKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattcaaatgaccactcccctcgtggagatggacggcgacgaaatgacaagg
atcatctggcggcagataaaggagactctcatcctgccccatgtggagctgaagacggaa
tattacgacctcggcctcaaacaccgcgacgagacggacgaccaggtgacggtggactcc
gccgaggcgacgaaaaaatacggcgtcgccgtcaagtgcgcgaccatcacccccaacgcg
cagcgtgtggaggagtacggccttaaaaagcagtggaagagcccgaacgggacgatccgg
gcgctccttgacggcacggtattccgcgcgccgatcatggtgaagggcgtacgccccacc
gtcagcacctggaagaggcccatcaccatcgcccgccatgcctacggcgatatatataag
gatgtcgagatgaacatcccctgcgccggaacgctgaagatgatcttcgagccagcggac
ggcgatgccggcaagcgccaggaggagacggtttttgaatataagggccccggcgtggcg
atggggatgcacaaccttgaaaaatcaatctccagctttgcgcgcgcctgctttaaatac
gcactggataccgggcaggatctctggttctcgacaaaagacaccatctccaagaaatac
gaccagaccttcaagctgatctttgaggatatctatgaaaaagagttccgcgccgaattt
gaaaaggcgggtatcacgtacttctatacgctgatagacgacgccgtggcgcgcgtcgtc
cgctccgagggcggctttatctgggcctgcaaaaactatgacggagacgtgatgtccgac
atggtggccaccgccttcggaagcctcgcgatgatgacctccgtgcttgtatcgccggat
ggcgtctacgaatacgaggcggcccacggtacggtgacgcgccattactaccagcatctg
gagggaaagacgacctcgacgaatcccatggcgaccatcttcgcctggagcggcgcgctc
cgcaagcgcggtgagctggacggcaacgccgcacttcaggagttcgccggacgtctggag
agggcctctattgaaacgattgagagcggcgaaatgacgaaggatatcttcgccatctcc
gaggtgccgaataagaagatgctgacgactgaggaatttctccagtcgatagccgggaag
ctgtaa

DBGET integrated database retrieval system