KEGG   Cloacibacillus porcorum: BED41_15730Help
Entry
BED41_15730       CDS       T04453                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cpor  Cloacibacillus porcorum
Pathway
cpor00260  Glycine, serine and threonine metabolism
cpor01100  Metabolic pathways
cpor01110  Biosynthesis of secondary metabolites
cpor01120  Microbial metabolism in diverse environments
cpor01130  Biosynthesis of antibiotics
cpor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BED41_15730
Enzymes [BR:cpor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BED41_15730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 RNA_POL_M_15KD
Motif
Other DBs
NCBI-ProteinID: ANZ46423
UniProt: A0A1B2I8Y6
Position
3522163..3523188
Genome map
AA seq 341 aa AA seqDB search
MIRFECDYGEGAHPLILERLAATNMEQTAGYGEDPHCEAARGYIRELCRMPDADVHFLVG
GTQANLAVIAAALRPHQGVIAAESGHINVHETGAVEATGHKVITVAGEEGKVTADEIRVV
YESHWKDPTHEHLAQPAMVYISNPSEIGTVYTLAELEEIAKVCRKCGLPLFMDGARLGYG
LACELCDYTLADIAALCDVFYIGGTKVGALFGEAVVITSDTLKRDFRYIMKQRGGMLAKG
RLLGIQFETLFEDGLYFRISEHAVRLAMKLRAACAAKGYSFLVDSRTNQQFPILPNGLIE
KLGERYSFALWQPTDAAHTAVRFCTSWATKEEHLDELVAAL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatccgttttgaatgcgactacggcgagggggcccacccccttatattggagcggctc
gccgccacaaacatggaacagacggcgggttacggcgaggacccgcactgcgaggcggcc
cgcggttacataagggagctctgccgcatgcccgacgccgacgtacatttcctcgtcggc
ggcacacaggctaacctcgcggtcatcgccgccgcgctgcgcccccaccagggcgtgatc
gccgccgagagcggccatatcaacgtccacgagacgggagcggtcgaggcgacgggacac
aaggtcatcaccgtggccggcgaggagggcaaggtcaccgcagacgagatacgagtcgtc
tatgagagccactggaaggacccgacccatgaacacctcgcccaaccggcgatggtctat
atctcaaaccccagcgagatcggaacggtctacacgctggcggagcttgaggagatcgcc
aaggtctgccgcaagtgcgggctgccgctctttatggacggcgcgcgcctcggctacggt
ctggcctgcgagctctgcgactatacgctcgccgatatcgccgccctctgcgacgtcttt
tatatcggcggcacgaaggtcggcgcgctcttcggcgaggcggtcgtcatcaccagcgat
acgctgaaaagggacttccgctacataatgaaacagcgcggcggaatgctcgcgaagggg
cggcttctggggatacagtttgagacgctcttcgaagacggcctctacttcaggatatcg
gagcatgccgtacggctggcgatgaagctccgcgcggcctgcgcggcaaagggctattct
ttcctcgtcgactcgcggacgaaccagcagtttcctatcctgcccaacggcctcatcgaa
aagctcggggaacgctattctttcgccctctggcagccgacggacgcggcgcacacggcg
gtgcgcttctgcaccagctgggctacgaaagaggagcatctagacgaactggtagcggct
ctgtaa

DBGET integrated database retrieval system