KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_0578Help
Entry
CpP54B96_0578     CDS       T01771                                 

Definition
(GenBank) Methylmalonyl-CoA carboxyltransferase 5S subunit
  KO
K03416  methylmalonyl-CoA carboxyltransferase 5S subunit [EC:2.1.3.1]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00640  Propanoate metabolism
cpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CpP54B96_0578
Enzymes [BR:cpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     CpP54B96_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like DUF1654
Motif
Other DBs
NCBI-ProteinID: AFF21725
Position
599458..600939
Genome map
AA seq 493 aa AA seqDB search
MSPRKIGVTEVALRDAHQSLFATRMAMEDMVDACEDIDKAGFWSVECWGGATFDACIRFL
NEDPWERLRTFRKLMPNSKLQMLLRGQNLLGYRHYENLVVDKFVEKSKENGMDVFRVFDA
LNDPRNLEHAMRAVKKVDGHAQGTICYTVSPLHTVEGYVELAGRLLDMGADSIALKDMAA
LLKPQPAYDVIRGIKETYGEDTQINVHCHSTTGVTLVTLMKAIEAGADVVDTAISSLSLG
PGHNPTESLVEMLEGTDYTTDLDMDRLINVRDHFKAIRPKYKEFESKTLVDTNIFLSQIP
GGMLSNMESQLTAQGAGDRIDEVMREVPIVRKDAGYPPLVTPSSQIVGTQAVFNVLMGRY
KVMTAEFADLMLGYYGECIGERNPEIVEQAKAQTKKEAITVRPADLLEPEWDHLVEEANK
LEGCDGTDEDVLTNALFPGVAPGFFKNRPEGPKNVGKDPSKIKTRENEAVLEPITYKVTV
GGRSQTVKVEPAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaagaaaaattggagtgactgaggtcgctttacgcgacgcgcatcagagtttg
tttgcaactcgtatggctatggaggacatggttgatgcgtgtgaggacatagataaagca
ggattctggagcgtggagtgctggggtggtgcaacgtttgatgcgtgcatcagattcctt
aatgaggatccctgggagagacttcgcaccttccgtaagttgatgccaaattccaagctc
cagatgctgctccgcgggcagaaccttctgggatatcgccactatgaaaacttggtagta
gacaagtttgttgagaagtccaaggaaaacggcatggatgtattccgtgtctttgacgct
ctcaatgatccacgcaacctagagcacgctatgcgggcggtgaagaaggttgatggacac
gctcagggaaccatctgctacaccgtttcaccactacacaccgttgaaggatacgttgag
cttgctggtcgccttctagatatgggggcagattccatcgcgctgaaggacatggcagcg
cttttgaagccgcaaccagcgtatgacgttatccgtggaattaaagagacctacggcgaa
gatactcagatcaacgtccactgccactccaccaccggcgtcacgctagtaactttgatg
aaggccattgaagctggcgcagacgttgtggataccgccatttcctctctctcactcggg
ccaggccacaaccccaccgagtctctcgtagagatgcttgagggcaccgactacaccact
gacctagacatggatcgcctgatcaacgtgcgcgatcacttcaaggcaatccgtccaaag
tacaaggaatttgagtccaagacgttggtggataccaacatcttcctctcacagattcct
ggcggcatgctttctaacatggagagtcagctgaccgctcaaggcgccggagatcgtatc
gacgaggtgatgcgggaggtcccaatcgtccgcaaagatgcaggatacccgccactggtt
actccatcttcccagatcgtgggaacccaggctgttttcaacgtccttatggggcgttac
aaggtaatgactgcagaatttgcggatctgatgcttggttactacggcgagtgcataggc
gagcgcaatcccgaaatcgtggagcaggcaaaggcacagaccaagaaggaagctattact
gtgcgtccggctgacctccttgagccagagtgggatcaccttgtggaggaagcaaacaag
cttgaaggctgcgatggcacagacgaagacgtgcttaccaacgcgctgttcccaggcgtc
gccccaggcttctttaaaaaccgccccgaggggccaaagaatgtgggtaaggacccatca
aagatcaagacccgcgagaatgaggccgttctcgaaccgattacctacaaggtcaccgtg
ggcggtcgcagccagaccgtcaaggtcgagcccgccgagtaa

DBGET integrated database retrieval system