KEGG   Corynebacterium pseudotuberculosis P54B96: CpP54B96_1315Help
Entry
CpP54B96_1315     CDS       T01771                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cpp  Corynebacterium pseudotuberculosis P54B96
Pathway
cpp00020  Citrate cycle (TCA cycle)
cpp00620  Pyruvate metabolism
cpp01100  Metabolic pathways
cpp01110  Biosynthesis of secondary metabolites
cpp01120  Microbial metabolism in diverse environments
cpp01130  Biosynthesis of antibiotics
cpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CpP54B96_1315 (mqo)
   00620 Pyruvate metabolism
    CpP54B96_1315 (mqo)
Enzymes [BR:cpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CpP54B96_1315 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFF22450
Position
complement(1412266..1413765)
Genome map
AA seq 499 aa AA seqDB search
MADSTNAQRVTDEVDVALIGGGIMSATLGAMLRTLEPSWSQVLFERLDAPAQESSSPWNN
AGTGHSALCELNYTPEVNGRIEINKALGVNEKFQVSRQFWSYQINQGVLPNPHEWINPVP
HVSFARGESQVSYLKKRYDALASHPLFPNMQYTDDRSVFNEMLPLMADGRSEFEKIAISW
TDAGTDINYGSQTRQFLKAAEANGTNIRYGHEVKDITRDSGKWKIKVKNVHTGDIQVVRA
NFVFVGAGGMALPLLQKSGIAEIRGWGGFPVSGQWLRCTNQEIIEQHSAKVYGKASIGAP
PMSVPHLDTRVIDGEKGLLFGPYAGWTPKFLKKGSYLDLFKSIHPTNLMSYLGVGAQEFG
LTKYLITEVLKDQAARMESLREYMPNARDEDWELVTAGQRVQAIEPVVGPRFSTLAFGTS
LINSADGSIAGILGASPGASIAPAAMLEVLERCFGHCMVEWGDRIKEMIPSYGIKLSTDK
RLFEEIWNYTQTTLQLDKD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcagattccaccaacgcgcaacgcgtcacggacgaagtagacgttgccctgatcggc
ggcggtatcatgagtgccaccctgggcgctatgctccgcacacttgaacctagctggtct
caggttctctttgagcgtcttgacgcacctgctcaagagtcatcctcgccatggaataat
gcgggaacaggacattcggctctgtgtgagctgaactacacaccggaagttaacgggcgt
attgagatcaataaggctctgggtgtaaatgaaaagttccaagtttctcgccagttctgg
tcttatcaaattaaccaaggggttctcccgaatcctcacgagtggattaaccctgtaccg
cacgtttcttttgcccgtggtgaatcgcaggttagttatttgaaaaagcgttacgacgct
ctagctagccacccattattccccaacatgcaatatacggacgaccgtagcgtgttcaat
gagatgctcccgttaatggctgatgggcgcagtgaatttgaaaaaatcgcgatttcctgg
accgatgccggcactgatattaactatgggtctcagactcgccagttcctcaaagctgcc
gaggctaatggcaccaatatccgttatggacatgaggtcaaagacattacccgcgatagt
ggtaaatggaagatcaaagtcaaaaacgttcataccggagatattcaggttgttcgtgcc
aactttgtttttgtgggcgctggaggaatggcacttccgcttctccagaagtctggaatc
gcagaaatacgtggttggggcggtttcccggtatcgggtcaatggttgcgctgtactaac
caggaaatcatcgagcaacactcggcgaaagtttatggcaaagcatctatcggtgcgccc
ccgatgtcagtaccgcacctggatacccgcgttattgatggggaaaaaggcctgttgttt
ggtccttatgcgggatggacaccaaaattcttaaagaagggctcgtacctcgatcttttt
aagtctatccatcccacaaacctcatgtcttatctaggcgttggggctcaggaatttgga
ctaaccaagtacctcatcactgaggtactaaaggaccaagctgcccggatggagtctctg
cgtgagtacatgcctaatgctcgtgatgaagattgggagctagttacggcaggtcaacgc
gtacaggctatcgagcctgttgttgggccgcgattctccacgctggcttttggcacttcc
cttattaactcagcagatggatctatcgctggtattcttggtgcatcgccaggggcttct
attgcgccagctgcgatgttggaggttcttgagcgttgctttggacattgcatggttgag
tggggagacaggattaaagagatgatcccttcctacggaattaaactttccacagataag
cggctatttgaggagatctggaattatacccagacaacgctgcagcttgataaagactga

DBGET integrated database retrieval system