KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0043Help
Entry
CpC231_0043       CDS       T01877                                 

Gene name
fecD
Definition
(GenBank) Fe(3+) dicitrate transport system permease protein fecD
  KO
K02015  iron complex transport system permease protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq02010  ABC transporters
Module
cpq_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CpC231_0043 (fecD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpq02000]
    CpC231_0043 (fecD)
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    CpC231_0043 (fecD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD ABC-3
Motif
Other DBs
NCBI-ProteinID: ADL09542
UniProt: D9QDG9
Position
complement(43307..44431)
Genome map
AA seq 374 aa AA seqDB search
MPHHNAIKQLSGKTAGASKQLTTRRRQTAKTRLICAVLTVAILILLIVSGATGTVDVSLL
EAAQIVTGHLIPNMPWMSDGSLSTLQDQAVWQFRLPRTLLAGVAGAGLALAGALMQVTVR
NPLAEPYILGVSSGASVGAVLVIVLGSAALGGLPLNIAAFLGALCACIAVSLLARKDGTL
SPTRMILAGVALGTLLSAITSYLTISTSAQNVVSVMFFLLGSVSAASLSSVVAPLVALLV
SLVVTYMLARHLNVLMTGDESAMSLGVNATKLRALLLVIASVLTGTVVAVAGGIGFVGLV
VPHIARIAVGADHRRMIPVTVLGGMAFLMAADLLARTIAHPTEIPLGILTAFVGAPFFLW
LMRQGGAEKAGYGR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaccacaatgcgattaaacagctcagcggcaaaacggcgggtgccagtaagcaa
ctcaccacccgccgacgccaaacagccaagacacgactcatctgcgccgtcctaaccgtt
gccatcctcattcttcttatcgtttccggagcaaccggaaccgttgacgtcagcctttta
gaggctgcacaaatagtgacagggcatctcattcccaatatgccctggatgagcgatggc
agccttagcaccctgcaagatcaggccgtatggcaatttcgacttccccgcacactacta
gcaggggtcgcgggagcaggactagcgctagcaggggcattaatgcaggttaccgtgcgc
aatccattggcagagccttatatcctcggagtctcctccggagcaagcgtaggggccgtg
ctggtgatcgttcttggttcagcagctcttggcggcctccccttaaacatcgccgcattc
ctaggcgctctgtgcgcatgcatcgcagtctcactcctggcaaggaaagatggcacactt
tctcccactcgcatgatcctggcgggcgtcgctttgggcacattgctgagcgctataaca
agctacctcaccatttccaccagcgcacaaaacgtggtgagcgtgatgttcttcctgttg
ggatcggtgtcggcggcgtcgttaagcagtgtggtggcaccgttggtcgcgcttcttgtt
tcactcgtggtgacctacatgctggcaaggcatctcaatgtacttatgactggcgatgaa
tctgccatgtccttaggagtgaatgcgacgaaacttcgcgcactccttttggtcatagcg
tcggtcctcactgggaccgtggtggctgttgccggtggcatcggatttgtgggtcttgtt
gttccccatatcgcgcgcatcgcggtgggagcagatcaccgccgaatgattccggtaacg
gtactgggtggcatggcgtttcttatggcagcagatctactagcccgcacaatcgcgcac
cctacggagattccgctgggcatcctcaccgcttttgttggtgcgcccttcttcctgtgg
cttatgcgccagggtggcgcagagaaggcggggtatggccgatga

DBGET integrated database retrieval system