KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0055Help
Entry
CpC231_0055       CDS       T01877                                 

Gene name
opuBD
Definition
(GenBank) Choline transport system permease protein opuBD
  KO
K05846  osmoprotectant transport system permease protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq02010  ABC transporters
Module
cpq_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CpC231_0055 (opuBD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpq02000]
    CpC231_0055 (opuBD)
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CpC231_0055 (opuBD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADL09554
UniProt: D9QDI1
Position
complement(56064..56702)
Genome map
AA seq 212 aa AA seqDB search
MRWLRHAWPYVLDMAAAHLFLSIPAILISIAVSIPIGMFAARNPRVGNLVVSAASLAYTI
PALPMLILVPFIVGVPLRSDTNVIIALCIYGVALLARTATDAFRSIPEDVRMSASAQGMS
APQVALKVDLPLAIPVLISGIRVLGVSTIGLVTIGALIGVSSLGTLFTDGFQRNITAEVL
TGIGAVVILAVLFDVLCLILQRVLAPWSVIKK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggctacgtcatgcgtggccatatgtgctggatatggcagcagcccatctcttc
ctcagtattccagcaatccttattagtatcgcggtctccatccccatcggcatgtttgcc
gcccgcaatccgcgcgtaggaaacctagtggtatccgcggcctccctggcttatacaatc
cccgcccttcctatgctgatattggttcctttcatcgtgggagtacccctgcgatcagat
actaacgtcattatcgcgctatgcatctatggagtcgctcttcttgcacgtactgcaaca
gatgcttttcgttccatacctgaggacgtgcgcatgtccgcatctgcccaaggcatgagt
gcgccccaggttgcgttaaaggttgatctgcctcttgctattccggtattaatctccggc
attcgcgtgctcggtgtctccactattggcctggtgaccatcggcgcattaataggagtg
tctagcctgggaacactgtttactgatggttttcaacgcaatattactgctgaggtactc
actggtataggtgctgtagtcatactcgcggtgcttttcgacgtcctctgtctcatcctt
caacgcgtactcgcaccttggtcggtgataaagaaatga

DBGET integrated database retrieval system