KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0056Help
Entry
CpC231_0056       CDS       T01877                                 

Gene name
opuBA
Definition
(GenBank) Choline transport ATP-binding protein OpuBA
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq02010  ABC transporters
Module
cpq_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CpC231_0056 (opuBA)
Transporters [BR:cpq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    CpC231_0056 (opuBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_16 AAA AAA_15 AAA_25 AAA_23 AAA_30 AAA_28 cobW AAA_29 Zeta_toxin G-alpha AAA_22 AAA_33 NACHT DUF4397 PduV-EutP NB-ARC
Motif
Other DBs
NCBI-ProteinID: ADL09555
UniProt: D9QDI2
Position
complement(56699..57586)
Genome map
AA seq 295 aa AA seqDB search
MIEFIDVSKSYANPRKEKGDKKNKMPAGTASEKQTPTENAVNNFNLVIPENQTTVFVGSS
GCGKTTLLRMINRMVEPTSGEVHVRGRNVADVDPVELRRSIGYVIQSGGLLPHRKVLDNV
TTVPLLNREPKEEAIRRARLALETVELDPSFENRYPGELSGGQQQRVGVARALAADPDIL
LMDEPFGAVDPIVRRALQQQLIELQARLHKTVVVVTHDVDEAFLLGDNIVVLEKGGKIAQ
VGTPTEIFAQPANDFVAQFMGTHRSDRDLHTTVIGGSRVVVDKQGRPVGRLGADS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatttatcgacgtcagcaagagctacgctaacccccgcaaagaaaaaggtgac
aagaaaaataagatgccagcaggcacagcatctgaaaagcaaacgccaacagaaaatgct
gtgaacaacttcaaccttgttattccagaaaatcaaaccaccgtttttgttggttcctcc
ggctgcggcaaaaccacgctcctgagaatgattaaccgaatggttgaacccacgtctgga
gaggttcacgtgcgcggccgaaacgtggccgatgtcgatcccgtagagcttcgcagatcc
atcgggtacgtcattcaaagcggcggcctcctccctcaccgcaaggtgctggataatgtg
acaacggttcccctgcttaaccgcgagcccaaagaggaagctatccgacgcgcccggctg
gccctagaaacagtagagctcgaccccagctttgaaaaccgctatcccggtgagctttcc
ggcggacagcagcagcgcgttggcgtcgcccgcgcacttgccgcagacccagacattctg
ttgatggatgagccttttggtgcggtcgacccgatcgtgcggcgcgcactacagcaacaa
ctcattgagttacaggcccgcctgcataaaaccgtggtggtggtgacccatgatgtcgat
gaggccttcctcttaggcgataacatcgtggtgctagaaaaaggcggaaagattgcccaa
gttggaacgcccacggaaattttcgcacaaccagccaatgattttgtcgcccagttcatg
ggcacccatcggtcagatagagacttgcacaccacggtcatcggtggctcacgggttgtc
gtggataagcaaggtcgtccggtcggtcgactaggtgcagactcatga

DBGET integrated database retrieval system