KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0057Help
Entry
CpC231_0057       CDS       T01877                                 

Definition
(GenBank) Hypothetical protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MT0933_antitox FACT-Spt16_Nlob YtxH ISG65-75 DUF948 Phage_holin_6_1
Motif
Other DBs
NCBI-ProteinID: ADL09556
UniProt: D9QDI3
Position
complement(57943..58143)
Genome map
AA seq 66 aa AA seqDB search
MITAPQRKENLMDILNKAKELLDQNADKVKDAVEKVGDLVDEKTDGKFADKVDQVQEAVK
KKLDEK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgataactgcccctcaacgcaaggagaatctcatggacatcctcaacaaggctaaagaa
ctgctagatcaaaacgccgacaaggtaaaggatgcggtagaaaaagttggcgatcttgtc
gacgagaaaaccgacggcaagtttgcagacaaagtcgaccaggtccaagaggccgtaaag
aagaaattagacgaaaagtaa

DBGET integrated database retrieval system