KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0069Help
Entry
CpC231_0069       CDS       T01877                                 

Gene name
gca
Definition
(GenBank) Gamma-type carbonic anhydratase-like protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep HDPD
Motif
Other DBs
NCBI-ProteinID: ADL09567
UniProt: D9QDJ4
Position
69873..70430
Genome map
AA seq 185 aa AA seqDB search
MNPGPIILPFNGKTPRVHETAFIAPNATLIGDVEIAAHASVFYGCVLRADINMIRVGART
NIQDNSVLHVDGDAPCILGEDVTVGHMALVHGSTVGSGALVGMHSALLSHSVVGQGSLIA
AGAVVLEGQEIPAGVLAAGVPAKVRRELSSEQSAGFISHAGRYVHTASMHRELGAGLSLD
QVRFS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctggtccgattattttgccatttaacggcaaaactccgcgagttcacgagacc
gcttttatcgcgccgaacgctaccttgatcggcgacgtagagatagcggcgcatgcctct
gtgttttatggatgtgttttaagggcggacatcaacatgatccgtgtgggcgcccgaacc
aatattcaagataattcagtgttgcatgtcgacggcgatgcaccgtgcatcctaggcgag
gacgttactgtggggcatatggctttagtgcatggctctaccgtggggagcggggctctg
gtgggtatgcactctgcattgctttcgcactcggttgttggccagggaagcttgattgct
gcaggggccgtagtacttgagggacaagaaatacccgccggggtccttgctgcgggggtt
ccggctaaagtccggcgggagctttcctctgagcaatcggcgggttttatctcgcatgcc
ggcagatatgtgcatactgccagcatgcacagggagcttggggcgggcctgagtttggat
caggtgcgctttagctag

DBGET integrated database retrieval system