KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0089Help
Entry
CpC231_0089       CDS       T01877                                 

Gene name
cfp30B
Definition
(GenBank) Antigen Cfp30B
  KO
K06996  uncharacterized protein
Organism
cpq  Corynebacterium pseudotuberculosis C231
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CpC231_0089 (cfp30B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ADL09587
UniProt: D9QDL4
Position
88854..89678
Genome map
AA seq 274 aa AA seqDB search
MPAFQAASGMPYWIDLTSSDLRKSTYFYTQVLGWEIEEFGQDYYLARVQGLPVAGFIKRP
EDQQQADTWVTYFLTDNIHADCEGVEKLGGRVLAAPMEVRLGLMSIVVDNSGALFGLIQP
AGEEAFIAAGEPGTPVWHELTCTTGYAKAVKFYPSLFNWTTATVDSDHNFEYTTAETDGG
AFAGIFNAEGQFPPQVPSFWQTYLGVSNMDEAVRKTKEFGGEVIREPFASEFGLMSIISD
STGATVTICEVEEAVEEGRESDPLEGIDLSQFGI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccagccttccaagctgcgtcggggatgccatattggattgacctaacgtccagtgac
ctgcgtaagtcaacatacttctatacccaagtgttgggatgggagattgaagagtttggc
caggattattatctcgctcgtgtgcaaggcctcccagtagcgggattcattaaaaggcct
gaggaccagcaacaagctgatacctgggtgacttatttcctgacagataacattcatgct
gattgtgagggcgtcgaaaagctgggtgggcgtgtgctcgcggcgccgatggaagtacgg
ctcggtcttatgtccattgtcgtggataattcaggtgcactttttggattaatccagcct
gctggggaggaagccttcattgcggctggcgagccaggaacgccagtttggcatgaatta
acgtgcactacaggctacgccaaagcggtgaagttttatccttctctgttcaattggact
acggcaacggtggactctgatcataattttgagtacaccacagcagaaactgatggcggt
gcttttgctggcatttttaacgcggaagggcagttcccgcctcaagtccctagtttttgg
cagacctatctgggcgtctctaacatggatgaagcagtgaggaagacaaaggaattcggc
ggagaagtgattcgtgagccttttgcctcggaatttggtttgatgagcatcatttccgat
tctacgggagccacagtgacaatatgcgaagtagaagaagctgtggaagaaggccgtgaa
tctgatcctcttgagggaattgatctcagccaatttgggatttaa

DBGET integrated database retrieval system