KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0127Help
Entry
CpC231_0127       CDS       T01877                                 

Gene name
norB
Definition
(GenBank) Nitric-oxide reductase, cytochrome b-containing subunit I
  KO
K04561  nitric oxide reductase subunit B [EC:1.7.2.5]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00910  Nitrogen metabolism
cpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CpC231_0127 (norB)
Enzymes [BR:cpq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.5  nitric oxide reductase (cytochrome c)
     CpC231_0127 (norB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX1
Motif
Other DBs
NCBI-ProteinID: ADL09624
UniProt: D9QDQ1
Position
127527..129827
Genome map
AA seq 766 aa AA seqDB search
MALLEAPQRMSSRDKRWWSALAAVIIASFVVLLWMGQQINVHKPPIPERVETAQGKVLVT
KDQIINGQQVWQSIGGQQIGSVWGHGAYVAPDWTADWLHREATQILDKWAQKEGASDYAA
LGVEKQAALKARLKSELRTNGYQDGRIVLSDDRVAAFEANKKYYAELFANGHENYAIPKD
SIKDEAAAQDMAAFFWWTSWAASTNSPGSEETYTQNWPHEQLIDNVPPTSNILWSIISFI
LLLAGIGGLVWYQGWKGEENETPDVTPEKDPLLGFKPTPSQRATLKYFFIVGLLFVLQIA
CGIIAAHYGVEGGALFGIPIDKILPYAVVRTWHTQLGIFWIATAWFATGLYVGPAVGGKE
PKFQRLGVNILFGALLVVVLGSMAGEWASIMGKLGYGNPINFWLGTQGYEYVDLGRVFQI
GLFIGLALWFILMWRALAPAVRKAKTVPGKIMPTPEAPLAAGTQRSLTAMLLMSCLAIAG
FYGAAFGVNHETHLSIAEYWRWWVVHLWVEGFFEVFATTVIAFLFARIGLVRPAAATTSV
IVSTTIFLAGGIIGTAHHLYFSGAPAHVMALGAVFSALEVVPLALIGVEAFRNLNLLKLQ
PWVAGYKWAIYFFVSVSFWNMLGAGVFGFLINPPISLFYVQGLNLTPLHGHTALFGVYGM
LGIGLMLFCVRSLMPNANWDDRWLKWGFWGMNGGLLAMSLLSLLPLGLAQAWASMDVGLW
YARSDSFLYTPVLTFIRWLRVPGDIIFAVGALAIGVFMVRLVARKK
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcttttagaagccccgcaacgtatgtcctcacgagataagcgatggtggtctgcg
cttgctgcagtgatcatcgcttcttttgtggtgttgctatggatggggcagcaaatcaat
gttcacaaaccgccgattcctgaacgagttgaaaccgctcagggaaaagtgctggttacc
aaagaccagatcatcaacgggcaacaggtatggcagtccatcggtggacagcagatcgga
tctgtgtgggggcacggcgcatacgttgcaccagactggactgctgattggctccaccgt
gaggccacgcaaatcctggataaatgggctcagaaagaaggcgccagcgactatgcagcg
ttgggtgtggaaaagcaagcggcgctgaaggcacgactcaagagtgagttgcgtactaac
ggttaccaagacggacgcatcgtgctgagcgacgaccgggttgccgcctttgaagcgaac
aaaaaatactatgcagagctctttgcaaacggacacgaaaactatgccatcccaaaggac
tccatcaaggatgaggccgcagctcaagacatggctgcgttcttctggtggactagttgg
gcagcatctaccaactcgcctggaagcgaagaaacctacacccagaactggccgcatgag
cagttgatagataacgtgccgcctactagcaacattctgtggagcattattagctttatt
ctcctgcttgctggcattggtggcctggtttggtatcagggctggaagggggaagaaaat
gaaactccagacgtcactccggaaaaagatccgctgctcggcttcaagccaacgccgtcg
caacgcgcaacccttaaatacttctttatcgtcggcctgttgttcgtgttgcagatcgcc
tgcggcattatcgcagctcactatggtgttgaaggaggagcgttatttggcatacccatc
gataaaattcttccgtatgcggtagttcgaacttggcacactcaactgggtatcttttgg
atcgctactgcctggtttgccaccggtttgtacgtggggccagccgtaggaggaaaagag
ccgaaattccagcgcctaggtgtgaatatcctcttcggcgctctccttgtagtggtgctc
gggtcgatggcgggcgaatgggcctccattatgggcaagctgggctatggaaaccccatc
aacttctggctgggaacccaaggttatgaatatgttgatcttgggcgtgtcttccagatc
ggactattcattggtttggctctctggtttatcctcatgtggcgcgcgctcgcacctgca
gtgcgaaaggccaaaaccgtgcccggcaagatcatgccaaccccggaggctcctctcgcc
gctggaacgcaacgttctctgacggccatgctcctcatgagctgccttgcgatcgctggt
ttctatggcgcagcttttggagttaaccatgaaacgcatctttccatcgctgaatactgg
cgctggtgggtggttcacctctgggtagagggcttctttgaagtctttgccaccacggtc
atcgcattcctctttgcgcgaattggtttggtgcgaccggcagcggccacgacctcggtg
atcgtgtccaccaccatcttcctagctggtggcatcatcggaactgcacaccacctgtac
ttctctggagctcctgcacacgtcatggccctaggtgcggttttcagcgccctggaagta
gtgccgcttgcccttatcggtgtggaggcattccgtaatctcaatctgctcaagctccag
ccatgggtagctgggtacaagtgggctatttacttctttgtttctgtgtccttctggaac
atgcttggtgctggtgtctttgggttccttattaatccgccaatctcactgttctatgta
cagggcctcaacctcacgccgctgcacgggcacaccgcattgtttggtgtgtacggcatg
ctcggcatcggcctcatgcttttctgcgtccgttccctcatgccaaacgctaactgggat
gatcgttggctgaagtggggtttttggggaatgaacggcggtctactcgcaatgtctttg
ctttcccttcttcctttgggattggcgcaagcatgggcctctatggatgtgggactctgg
tacgcccgtagcgattccttcctttacacccctgtactcaccttcatccgttggcttcgg
gttccgggtgacatcatctttgccgtcggcgccctagcgatcggcgtatttatggttcgt
cttgttgctcgtaaaaaatag

DBGET integrated database retrieval system