KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0132Help
Entry
CpC231_0132       CDS       T01877                                 

Gene name
pdxT
Definition
(GenBank) Glutamine amidotransferase subunit pdxT
  KO
K08681  5'-phosphate synthase pdxT subunit [EC:4.3.3.6]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00750  Vitamin B6 metabolism
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CpC231_0132 (pdxT)
Enzymes [BR:cpq01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.6  pyridoxal 5'-phosphate synthase (glutamine hydrolysing)
     CpC231_0132 (pdxT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNO GATase_3
Motif
Other DBs
NCBI-ProteinID: ADL09629
UniProt: D9QDQ6
Position
133411..133977
Genome map
AA seq 188 aa AA seqDB search
MVIGVLALQGGFAEHIAVLSRCGAKTRRVRVAQDLEGLKGLVIPGGESSVIDKLARALGL
AEPLAQSIGAGLPVFATCAGLIYLGQVENPAPGQRSLGCLDAVVRRNAFGRQTDSFDTRI
RVFDRIEADVSFIRAPEIISWGSDVEVTARVGGRVVGVKQGLIHAYAFHPESAGETRLHE
EWLREIGR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggtaattggagttcttgcccttcaaggcgggtttgccgagcatatcgcggttttatct
cgttgtggagcaaaaacgcgtcgcgtgcgcgttgcccaagaccttgaggggcttaaaggg
ctagtgattcccggtggcgagtcctcggtgatcgataaactagcccgtgccttgggcctg
gcagagccacttgcccaatctattggggcggggctgccagtttttgctacctgcgcgggg
ctgatttacctggggcaggtagaaaatcccgctccaggtcagcgcagtcttggatgcttg
gacgcagttgtgcggagaaatgcttttggcaggcagaccgactcctttgatacccgaata
cgcgtatttgatcggatagaggccgatgtgtcctttatccgggcgccggagatcatctcg
tggggttcagacgttgaggtgaccgcgcgtgtgggaggtcgagtggtgggagtgaagcag
ggattgatacatgcatatgctttccatccggagtcggcgggcgaaactcggttgcatgag
gaatggttgcgcgagataggacgctga

DBGET integrated database retrieval system