KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0151Help
Entry
CpC231_0151       CDS       T01877                                 

Gene name
mmsB
Definition
(GenBank) 3-hydroxyisobutyrate dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00280  Valine, leucine and isoleucine degradation
cpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpC231_0151 (mmsB)
Enzymes [BR:cpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     CpC231_0151 (mmsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_11 NAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N F420_oxidored TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADL09648
UniProt: D9QDS5
Position
complement(152545..153453)
Genome map
AA seq 302 aa AA seqDB search
MSLIVTVVGLGAMGLPMATNLVQNFTVRGVDIAQSRLELGKAAGLETFHSAHQAATGADV
VLLAVRNEEQLIQALFGQGNIAAALKPGAVVLLTSTVGITAVEKAAEQLDSLGIDVVDAP
ISGGPGRAGSGELLVTVGAKPEVVDRIRPVLEAMSSHLVIVGDRPGKGQALKTVNQLLCG
VHIAAAGEALALADRLGLDPKAALDALMGGAAASFMLGDRGPRMLEAYSEEGPEVRSRLD
IFVKDMGIVTDAAKSAGIGVPLAAAAEQQYLAGLARGKGAQDDSTIIQVVAPTQVNKTRS
KQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcatcgttactgttgtcggcttgggcgctatgggactccccatggccaccaac
ctcgtccagaatttcacagtccgaggcgtcgatatcgcacaatcgcgcctcgaattaggc
aaggccgctgggctggaaaccttccattcggcgcaccaagcagccacaggggctgacgtt
gttttgctagcggttcgcaacgaggaacaacttattcaggccctctttggacaaggcaat
atcgctgcggctctcaaacccggcgcggttgtacttttgacttctaccgtgggcattacg
gccgtggaaaaagctgccgagcagcttgactcattgggtatcgatgttgtcgatgccccc
atttccggcggccccggacgagcaggcagcggggagctacttgtcacagtgggagccaag
cctgaggtggtcgatcgcatcaggccggtgcttgaagccatgtcttcccacctggtgatc
gttggcgatcgcccgggtaagggccaagcgctaaaaaccgtcaatcaacttttatgcgga
gttcatatcgctgccgcaggcgaggcgctggcgctagccgatcggttgggtcttgatccc
aaagccgcgcttgatgcgttgatgggcggcgccgcagcctccttcatgcttggcgatcgt
ggcccccgcatgctggaagcttattcggaggaaggacctgaagtccgcagccgtctcgac
atctttgttaaagacatgggcattgtcactgatgccgccaaatctgcaggcatcggtgtc
ccattagcagccgccgccgagcagcaatacctagctggtctagcacgagggaaaggcgcg
caagacgattccacgattatccaggttgtcgctcccacccaggtgaataagacaaggagt
aaacaataa

DBGET integrated database retrieval system