KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0154Help
Entry
CpC231_0154       CDS       T01877                                 

Gene name
hpaF
Definition
(GenBank) 2-hydroxyhepta-2,4-diene-1,7-dioatesomerase
  KO
K16164  acylpyruvate hydrolase [EC:3.7.1.5]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00350  Tyrosine metabolism
cpq01100  Metabolic pathways
cpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CpC231_0154 (hpaF)
Enzymes [BR:cpq01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.5  acylpyruvate hydrolase
     CpC231_0154 (hpaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase DUF1730
Motif
Other DBs
NCBI-ProteinID: ADL09650
UniProt: D9QDS7
Position
155864..156712
Genome map
AA seq 282 aa AA seqDB search
MRLATIRTQGTTTAARIEGTDLAVAIPGFYDVGELLQKSDWQELARSASGTPVRFSQQDL
HAVIPSPKKIICVGLNYSNHIKEMGRTLPEVPTLFVKFSDALTGPFDDIPIPPWANSALD
WEGELAVVISRHARRVKASEAEEYIAGYAVMNDYSARDYQYATLQWHQGKSLEKTAGFGP
WLTTRDSFDLSGELKTYLNEEKVQSAAISDLVFKPADLIQYITHLYPLDPGDVIVTGTPG
GVGHARDPRRYIGDGDVVTVEIKGLGRIANKTIFEKWKEPNN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttgcaaccataagaactcaagggacaacgactgccgcacgcattgagggcacc
gaccttgccgtagccattcccggcttttatgatgtcggcgagctgctgcagaagtccgac
tggcaggaattagcgagatcggcgagtgggacccctgtgaggttttcccaacaggatctt
cacgccgttattccttctcccaaaaagatcatctgtgtgggactgaactattccaatcac
atcaaagaaatgggacgtacgctgccagaagttcccaccttatttgttaaattttctgac
gcacttacagggcctttcgacgatatccccatcccaccgtgggccaatagcgccctcgac
tgggaaggcgagctggcagtggtgatctcacgacacgcccgcagggtgaaagcctcggag
gcggaggaatacatcgctggatatgcggtgatgaatgactacagtgctcgtgattatcaa
tacgctacgcttcagtggcaccaaggaaaatccctagaaaagacggcaggttttgggcct
tggctgaccacgcgagactcttttgacctcagcggagagctgaagacgtatctgaatgaa
gaaaaggtgcaaagtgcggctattagcgatttagtgtttaaaccagcagaccttatccaa
tacatcacgcatctttatcccttggatcctggcgacgtgatcgtgaccgggactcctggc
ggagttgggcacgcgcgtgatcctcggcggtatatcggcgacggtgatgtggtgacggtg
gagattaaggggctagggcggatagctaacaaaacgatttttgaaaaatggaaagagccc
aacaattga

DBGET integrated database retrieval system