KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0172Help
Entry
CpC231_0172       CDS       T01877                                 

Gene name
lysC
Definition
(GenBank) Aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00260  Glycine, serine and threonine metabolism
cpq00261  Monobactam biosynthesis
cpq00270  Cysteine and methionine metabolism
cpq00300  Lysine biosynthesis
cpq01100  Metabolic pathways
cpq01110  Biosynthesis of secondary metabolites
cpq01120  Microbial metabolism in diverse environments
cpq01130  Biosynthesis of antibiotics
cpq01210  2-Oxocarboxylic acid metabolism
cpq01230  Biosynthesis of amino acids
Module
cpq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
cpq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpC231_0172 (lysC)
   00270 Cysteine and methionine metabolism
    CpC231_0172 (lysC)
   00300 Lysine biosynthesis
    CpC231_0172 (lysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CpC231_0172 (lysC)
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     CpC231_0172 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT
Motif
Other DBs
NCBI-ProteinID: ADL09667
UniProt: D9QDU4
Position
177592..178881
Genome map
AA seq 429 aa AA seqDB search
MSPGRALPVALVVQKYGGSSLESAERIRRVAERIVATKKQGNDVVVVCSAMGDTTDELLD
LAAQVNPVPPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVITTERHGNAR
IVDVTPGRVREALNEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAAALNADVCEI
YSDVDGVYTADPRIVSNACKLDQLCFEEMLELAANGSKILVLRSVEYARAFGVPLRVRSS
YSNDPGTLVAGSMEDIPVEEAVLSGVATDNSEAKITVLGIPDSPGAASVVFRALADAEIN
IDTVLQNISSLEDNRTDITFTCPRADGPHAMELLHNLQSKNDWQNVLYDDQIGKVSLVGA
GMKSHPGVTAEFCEALRDQGINIELITTSEIRISVLIRETDLPAAARALHEKFELGGDEE
ARVYAGTGR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgggaagggcgttgcccgtggcacttgtcgtccaaaaatatggcggttcttcg
ctggaaagcgcggaaagaattcgtcgcgtcgccgagcggattgtggccactaaaaagcaa
ggcaacgacgttgtagtggtgtgctccgcgatgggggatactaccgacgagctgcttgac
cttgcggctcaggtaaacccggtgccgcccgcgcgtgagatggatatgttgcttaccgca
ggggagcgcatctctaacgcacttgtggccatggctatcgagtcatttggcgcaaaagct
cagtcattcacaggctcgcaagcgggtgtaatcaccacagaacgccacggtaatgcccgt
atcgtggacgttactccggggcgagtacgtgaagctctgaatgaaggcaaaatttgtctt
gttgcgggcttccagggcgtaaaccgcgagtctaaggacgtgaccactttgggccgtggt
ggttcggacaccacggcggttgccctggctgcagcgcttaatgctgacgtatgtgagatc
tattcagacgtggacggcgtttatactgctgacccccgtattgttagcaatgcatgcaag
ttggatcagctctgctttgaggagatgctggagcttgcagctaatggctcaaaaattctt
gttctgcgcagcgtagagtatgcccgtgcgtttggtgtacctttgcgcgttcgttcgtcg
tatagcaatgaccccggaactctcgttgccggatcaatggaggatatccctgtggaagaa
gcagtactttctggcgtagcaactgacaactccgaggctaagatcacggtcctgggcatc
cccgattctccaggggctgcctctgtggtattccgtgcccttgcagacgccgagatcaac
attgatacagtcctgcaaaacatctcttccctggaagataaccgcacggatattactttc
acctgcccgcgtgccgacggcccccacgccatggaattgctgcacaatttgcagtcgaag
aacgactggcagaacgtgctttacgacgatcaaataggcaaagtttcactcgtcggcgcc
ggtatgaaatcgcacccaggcgttactgcagaattctgcgaggctctccgcgaccagggg
atcaatattgaattgattactacctctgagatccgtatctctgtgctgatccgtgaaact
gatttgcccgctgctgcacgagcgctccatgaaaagtttgaacttggtggagatgaagag
gctcgggtgtacgcggggacggggcgttaa

DBGET integrated database retrieval system