KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0511Help
Entry
CpC231_0511       CDS       T01877                                 

Gene name
manB
Definition
(GenBank) Phosphomannomutase ManB
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00051  Fructose and mannose metabolism
cpq00520  Amino sugar and nucleotide sugar metabolism
cpq01100  Metabolic pathways
cpq01110  Biosynthesis of secondary metabolites
cpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CpC231_0511 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    CpC231_0511 (manB)
Enzymes [BR:cpq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     CpC231_0511 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADL09998
UniProt: D9QES5
Position
524515..525894
Genome map
AA seq 459 aa AA seqDB search
MRTRESVTKVIKAYDVRGVVGVDIDADFIREVGSAFGHLMRNEGATKVAVGHDMRPSSPE
LTQAFADGLTAQGVDVVALGLTSTDQLYYASGVMDCPGAMFTASHNPAEYNGIKMCRSGA
RPVGQETGLGAIIDMLVEGVPAYDGKPGAITQKDTLADYGSFLRELVDLSGIRPLVVAVD
AANGMGGHTVPEVFAGLPLDVKPLYFELDGTFPNHEANPLDPKNLVDLQKFTPEVKADIG
LAFDGDADRCFVVDENGDPVSPSAICAIVAERYLAQHPGSTIIHNLITSKTVPEVIAENG
GVAVRTRVGHSFIKAQMAEHGAAFGGEHSAHYYFSEFFNADSGILAAMHVLAALGGQDKP
LSELMKEYSRYAASGEINSRLASAEEQAERTQAVLDAFADRTESVDRLDGVTVELQGTKA
WFNVRASNTEPLLRLNVEAPTAEEVDALVTEILGVIRQQ
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccgtgaatcggtgaccaaggtcatcaaggcttatgacgtgcgaggggtcgtc
ggtgttgatattgatgctgacttcatccgcgaggtaggctcggcttttggccatctgatg
cgcaacgagggcgctactaaggtcgccgtaggtcatgacatgaggccgtcatcacctgag
ctaactcaggcttttgcagacgggctcaccgctcaaggcgttgatgtggttgcgctaggg
ctcacctccactgatcagctgtattacgcttctggcgttatggattgccccggcgcaatg
ttcaccgcatcccacaaccctgccgaatataacggcatcaagatgtgccgctctggcgca
cgacccgtggggcaggaaactggtttgggcgcgattatcgacatgctggtggagggcgtc
ccggcttacgacggcaaaccaggcgctattacgcagaaagataccctcgcggattacggt
tccttccttcgtgaacttgtggatctgtctggcatccggcctcttgttgttgctgtggac
gcagcgaacggcatgggtgggcatactgtccctgaggtttttgcaggacttccactcgat
gtcaagcccctctactttgagctagacggaaccttccctaaccatgaggcaaacccgctc
gaccccaagaaccttgtggacctgcaaaaattcactccagaggtaaaagccgacatcggc
ctagcttttgacggcgacgcagatcgctgctttgtggttgatgagaatggcgacccggtg
agcccctctgctatttgcgccatcgtcgcagagcgataccttgcgcagcatccaggcagc
acgattatccataacctgattacctccaagacggttccggaggtaatcgcggaaaatggc
ggtgttgccgtgcgtacgcgtgtgggacattcctttattaaggcacaaatggcggagcac
ggcgcggcattcggcggcgagcactctgctcattactacttctctgagtttttcaatgcc
gattctggaatccttgcagcaatgcacgtgctagcggctctaggcggacaagacaagcct
ttgtcagagctgatgaaagaatattcgcgttacgcggcatcgggagaaatcaactcacgt
ttggctagcgctgaagaacaggctgagcgcacccaggctgttctggatgctttcgcggat
cgtacggaaagcgttgatcgtctcgacggcgttaccgttgagcttcaaggcactaaggcg
tggttcaatgttcgcgcttccaacacagaaccacttttgcgtcttaacgtcgaggctcct
acggcagaagaagtggacgccctagtcactgaaattcttggggttattcgtcaacagtag

DBGET integrated database retrieval system