KEGG   Corynebacterium pseudotuberculosis C231: CpC231_0952Help
Entry
CpC231_0952       CDS       T01877                                 

Gene name
argF
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
cpq00220  Arginine biosynthesis
cpq01100  Metabolic pathways
cpq01110  Biosynthesis of secondary metabolites
cpq01130  Biosynthesis of antibiotics
cpq01230  Biosynthesis of amino acids
Module
cpq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CpC231_0952 (argF)
Enzymes [BR:cpq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CpC231_0952 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ADL10430
UniProt: D9QA54
Position
1022760..1023761
Genome map
AA seq 333 aa AA seqDB search
MNTSTAFSSFDAAGSGKALARHFLADDDLTPLEQCEVLELAAELKKHPYSLTPLEGPQSV
AVLFDKTSTRTRFSFDAGIAQLGGNAIVVDTNASQMGKGETYQDTGAVLSRFVSAIVWRT
FAHSNLMEMAQTATVPIINALSDDLHPCQILADLQTCIEHLCAEEGPKGLRGKKAVYLGD
GSNNMANSYIIGFATAGINISIIAPTDFHPKEEFVARAQRRAEQTGAMVTVTDDLNEASG
AHIVITDTWVSMGMEKDGIDRRTPFIPYQVNDAIMDRTDENAIFLHCLPAYRGNEVTASV
IDGPQSVVFDEAENRLHAQKALMSWLLEHQPTA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgagtacagccttttcctcctttgacgctgcaggatctgggaaggcattagcc
aggcatttcttggcagatgatgatctcacacctttagaacaatgcgaagtattagaactg
gctgcggagttaaagaagcacccgtattctttaactccgttggaaggaccacagtcggtt
gcggtcttatttgacaagacctccacgcggacgcgattttcttttgacgcaggaatcgca
cagctaggtggcaatgcgattgttgtagacacaaatgcctctcagatgggcaaaggggaa
acgtatcaagataccggagcagtcctttcccggtttgtatcggccattgtatggcgcacg
tttgctcattctaacctcatggaaatggctcagactgctactgtgcccattattaacgct
ttgtctgatgatcttcacccctgccaaattttggcagatctccaaacctgtatcgagcac
ctttgcgcagaagaagggccgaagggattgcgcgggaaaaaagctgtctatttgggggac
ggcagcaataatatggcgaactcttatattatcggttttgccacagcgggtataaatata
agcatcattgctccaacggattttcatcctaaggaagaatttgtagcccgagcacaaaga
cgtgctgagcaaaccggagcaatggtcaccgtaactgatgatcttaatgaagcatcagga
gcgcatatagtgattacagatacatgggtgtctatggggatggagaaagacggtattgat
cgtcgaaccccctttatcccttatcaagttaatgatgccattatggatcgtactgatgag
aacgctatatttcttcattgtcttcctgcgtatcggggaaatgaagttactgcttctgtt
atcgatggcccgcagtctgtggtcttcgatgaggcggaaaatcgtctacacgcgcagaaa
gcacttatgtcttggctgctggaacaccagccgacagcctag

DBGET integrated database retrieval system