KEGG   Clostridium perfringens SM101: CPR_0057Help
Entry
CPR_0057          CDS       T00379                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPR_0057 (recR)
DNA repair and recombination proteins [BR:cpr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CPR_0057 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CPR_0057 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH_8 Cdd1
Motif
Other DBs
NCBI-ProteinID: ABG86072
UniProt: Q0SWS6
Position
63007..63603
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSV
CGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMQGRGP
QDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPLDVKVTRIAAGIPVGGDL
EYADEVTLSKALEGRTVI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatccagtagctatagaaaagttaattgaagagtttgctaagttacctagt
ataggaaaaaaatcagctcaaagattaactttacatattttgaatttgccaaaggatgag
gtagaggaatttgcaaatgccttagtaaaagcaagaggaactattaaatattgttctgta
tgtggtaactttacagatacagatccatgtgcaatatgttcaaatcctaatagagaaaaa
gatataatatgtgtggttgaacaacctaaggatattatgacaatggaaaaagttaaagaa
tttaatggtttatatcatgttttacatggaactatttctccaatgcaaggaagaggacca
caggatataagaataagagaattagtagcaagaatgagcggagatgtaaaagaggttatt
gtagctacaaaccctactattgaaggggaagctacagctatgtatatttcaaagatatta
aagccattagatgttaaggttactagaattgcagcaggaatcccagttgggggagattta
gagtatgcagatgaagtaactttatctaaagcattagaaggtagaactgttatataa

DBGET integrated database retrieval system