KEGG   Clostridium perfringens SM101: CPR_0532Help
Entry
CPR_0532          CDS       T00379                                 

Gene name
ribA
Definition
(GenBank) riboflavin biosynthesis protein RibA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00740  Riboflavin metabolism
cpr00790  Folate biosynthesis
cpr01100  Metabolic pathways
cpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPR_0532 (ribA)
   00790 Folate biosynthesis
    CPR_0532 (ribA)
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     CPR_0532 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     CPR_0532 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ABG87475
UniProt: Q0SVJ0
Position
631121..632320
Genome map
AA seq 399 aa AA seqDB search
MKKFNLVEEAIEDIKNGKMVIVIDDEGRENEGDLVMAGELVTGEKINFMATYGKGLICAP
VSESIAESLGLNPMVSHNTDNHETAFTVSIDYKNTTTGISAFERAHTIKELINEESKAED
FRRPGHVFPLIAKNGGVLKRAGHTEAAIDLAKLAGLKEVGVICEIMKDDGTMARTDELLE
FAKIHNMKIITIEDLIAYRTERDNFVYRVVETNMPTKYGEFKAIGFIDKLTGEHHVALVK
GEIKSEEPVLLRVHSECLTGDVFGSRRCDCGEQFHRAMEKINEEGKGILLYMRQEGRGIG
LINKLKAYKLQDEGLDTVEANIALGFPEDLRDYGVGAQILKELGVREIRLMSNNPKKITG
LEGYGLKIVERVPIEIKCNEENEFYLKTKKEKMHHLIMQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttaatttagtagaagaggcaatagaagatataaaaaatgggaaaatggtt
attgttattgatgatgagggaagagaaaatgagggggatctagttatggctggagaactt
gttactggagaaaaaataaattttatggccacttatggaaagggtttaatatgtgctcca
gtaagtgagagtatagctgaaagtttagggttgaatcctatggtttcacataatacagat
aatcatgaaactgcctttacagtatctatagattataaaaatacaactacaggaatatca
gcctttgaaagggctcatacaattaaagaattaataaatgaagaaagcaaggcagaggat
tttagaagaccaggacatgtatttcctttaatagctaagaatggtggcgttttaaagaga
gctgggcatacagaggcggcaattgacttagcaaagttagctggattaaaagaagttggg
gtaatatgtgaaataatgaaagatgatggaactatggctagaactgatgaattattagaa
tttgcaaagattcataatatgaaaataataactatagaagatctaattgcttatagaaca
gaaagagataattttgtttatagagttgttgaaactaatatgccaactaaatatggagag
ttcaaggctattgggtttatagataaacttacaggggagcatcatgtagctttagttaaa
ggagagataaaatcagaggagccagtattattaagagtacattcagaatgcttaactgga
gatgtttttggatcaaggagatgtgattgtggagagcaatttcatagggctatggaaaaa
ataaatgaagagggaaaaggaatattactttatatgagacaagaaggaagaggaataggt
cttataaataagttgaaagcttataagcttcaagatgaaggattagataccgtagaagct
aatatagccttaggatttccagaagatcttagagattatggcgttggagcacaaatttta
aaagagttaggcgtaagggaaatcaggttaatgagcaataaccctaaaaaaataactggc
ttagagggatatggacttaaaatagtagaaagagtacctatagaaataaagtgtaatgag
gaaaatgagttttatttgaaaactaagaaagagaaaatgcaccatttaataatgcagtaa

DBGET integrated database retrieval system