KEGG   Clostridium perfringens SM101: CPR_0864Help
Entry
CPR_0864          CDS       T00379                                 

Definition
(GenBank) pyrophosphatase, MutT/nudix family
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ABG86189
UniProt: Q0SUL8
Position
1001957..1002607
Genome map
AA seq 216 aa AA seqDB search
MNNIENIKDVFRDYKMGINGEEDMKRCSVLIPVVNIDGEDNIIFEIRNNKLNSNPGEICF
PGGTIEEGETPKEAALRECFEEIGLGEENLEIISQLDFYVSPNNILIYPFLGVQKNQKED
IKKFISINKEEVSDILLVPFKYLLNYEPEITYSKIINIPKEDFPFHNIIGGRDYKFRDGR
YKVMFYKYNNFVIWGMTARILENFLNVYKGHYNKNI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaataatattgagaatataaaagatgtgtttagagattataaaatgggtataaatgga
gaagaggacatgaaaagatgttctgttttaattccagttgtaaatatagatggggaagac
aatattatttttgaaataagaaataataaattaaatagtaatccaggtgaaatatgtttc
cctggtggtaccatagaagagggagaaactcctaaagaagctgccttaagagaatgtttt
gaggaaattggtcttggagaagaaaatttagaaattataagtcagttagatttttatgtt
tcacctaacaacatattaatttatccttttttaggagttcaaaaaaatcaaaaagaggat
ataaaaaaatttatttcaatcaacaaagaagaagtatctgatatattattagttcctttt
aaatatttattaaattatgaacctgaaattacctacagcaaaattataaatataccaaag
gaagattttccttttcataatataataggtggtagagattataaatttagagatggaaga
tacaaagttatgttttataaatataataattttgtgatttggggaatgactgctagaata
ttagaaaatttcttaaatgtatataaaggacattataataaaaatatttaa

DBGET integrated database retrieval system