KEGG   Clostridium perfringens SM101: CPR_0865Help
Entry
CPR_0865          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5412 C5-epim_C
Motif
Other DBs
NCBI-ProteinID: ABG87582
UniProt: Q0SUL7
Position
1002693..1003112
Genome map
AA seq 139 aa AA seqDB search
MDQRSLEKKCKFNERVILFTFLLTIATLIAIWISTFKYYYNEIKCNNVTMEKLPIGSFQE
EYKSPSKKYTINSYICSSGGVPDWAVRCEVVNNISGEVRNIYWDYKIKSIDVKWINDHIV
LINGHKIDVKNEVYDWRKI
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaaagaagtttagagaaaaagtgtaagtttaatgaaagggttattctatttaca
tttttacttactattgctacattaatagcaatttggatttctacatttaagtattattac
aatgaaattaagtgtaataacgttactatggagaaattacccataggaagctttcaagaa
gagtataaatctccaagcaaaaaatatactattaattcttacatatgtagctctggagga
gtacctgattgggccgtaagatgtgaagtggttaataatataagtggagaagtaagaaat
atatattgggattataagataaaatcaattgatgtaaaatggattaacgatcatatagtc
ttaataaatggacataaaatagatgttaaaaatgaggtttatgattggagaaaaatataa

DBGET integrated database retrieval system