KEGG   Clostridium perfringens SM101: CPR_0868Help
Entry
CPR_0868          CDS       T00379                                 

Definition
(GenBank) EAL domain protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL SBP_bac_3 NMT1 HEM4
Motif
Other DBs
NCBI-ProteinID: ABG87149
UniProt: Q0SUL4
Position
1005492..1007129
Genome map
AA seq 545 aa AA seqDB search
MKKRVSWVSIVFLIIIIGLAITIKFDCKKVNCNRKTIKVGFYEYYPYYYLNKNSMPDGYY
NEILELICNKINLNYEYVDCNITNALEKLKSGEVDLVFGISKTPDREKDYEFTDHYINND
NFAIYTNKNIKNGDLKALNGLKMGFLKGEENNEWILRFLKDKGINVKLIDVYNYPEDEEY
LHDNKVDFIIENKRSNIDYENKNIKKIFEFSSGPVYIVSRKGNKKLIERINSALGEIEDD
EENDTNLYFNDFDEYLNKLEIKKLFIGIFLIIITLFIYKKRKNKIFAIRTKRKIRNYMKN
DKYILYYQPIVDPKTNGVKGFESLLRLNKNGKILTPDSFIREIEDNNMSLEVSLWLLKKV
IADYRIIKDYRMVKGSNFYISLNVSFKEIENPKFLRSLMKIAKDYKIDDCNICLEIVEKF
GMEDIGRIQSAIRIIKEYGFLIAIDDFGVEYSNLDLLNKIDSDIVKLDKYFADNLDKSII
NKKTVEFISEICNISNRTIVFEGVEGKYQVNIIKAFPYEKIYIQGYFYSKPVDIETLKDF
EVKDS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagggtgtcttgggtaagtatagtatttttaataattataattggtttagca
attacaattaaatttgattgtaagaaagttaattgtaacagaaaaacaattaaagtagga
ttttatgaatattatccttattattatcttaataaaaattctatgccagatggctattat
aatgaaatattagaattaatatgtaataagataaatttaaattatgagtatgtagattgt
aatataacaaatgctttagaaaagcttaaatctggagaagtagatttagtttttggaata
agtaagacccctgatagagaaaaggattatgaatttactgaccattacataaataatgat
aactttgccatatatactaataaaaatataaaaaatggtgatttaaaagctttaaatgga
ttaaaaatggggtttttaaaaggagaagaaaataatgagtggattttaaggtttttaaaa
gataaaggcataaatgtgaagcttatagatgtatataattatcctgaagatgaagaatat
ttacatgataacaaagttgattttataatagaaaacaaaagaagtaatatagattatgaa
aataaaaatattaaaaaaatttttgagttttcttctggaccagtttatatagttagtaga
aaaggaaataaaaaattaattgaaagaataaattccgctcttggagagattgaagatgat
gaagagaatgatactaatttatactttaatgattttgatgaatatttaaataaattagag
attaaaaaattatttattggaatttttttgattataataacattatttatttataaaaaa
agaaaaaataaaatattcgctataagaactaaaagaaaaattagaaactatatgaaaaat
gataaatatatattatattatcaacctatagtagatccaaagacaaatggagtaaagggc
tttgaatctcttttgagattaaataagaatggaaaaattttaacacctgatagctttata
agggaaattgaagacaataatatgtctttagaggtttctttatggcttttaaagaaagtt
attgcagactacagaataatcaaagattataggatggtcaaaggaagtaatttttatata
tcattaaatgtttcatttaaagaaatagaaaatcctaagtttttaagatccttaatgaaa
attgcaaaagattataagattgatgattgtaatatttgtttagagatagtagaaaaattt
ggtatggaggatataggaagaatacagagtgcaataagaataataaaggaatatggattt
ttaatagctatagatgattttggtgtggagtattctaatttagatttattaaataaaatt
gattctgatatagtaaagctagacaagtactttgctgataatttagataagtctattata
aataaaaaaacagtggaatttatatcagaaatatgtaatatatcaaatagaaccatagta
tttgaaggagtagagggaaaatatcaggttaatattattaaggcatttccatatgaaaaa
atatatattcagggatatttctattcaaagccagtggatattgagactttaaaggatttt
gaagttaaggatagttaa

DBGET integrated database retrieval system