KEGG   Clostridium perfringens SM101: CPR_0869Help
Entry
CPR_0869          CDS       T00379                                 

Definition
(GenBank) flavin reductase
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: ABG87839
UniProt: Q0SUL3
Position
1007607..1008227
Genome map
AA seq 206 aa AA seqDB search
MKVLLVNGSPNREGCTYTALKEVSKTLEENGIDTEIFQVGNKPIGGCIGCGSCKKTGECF
MKDCVNEFVEKAKGADGFVFGSPVYYAAASGSITSFLDRAFYSGGKHMAFKPGAVICSAR
RAGTTSTLDQLSKYLTICNMPVVSSQYWNMVHGNTPEEVKKDLEGMQTMRVLGRNMAWLI
KCIDLGKKNNILKPELEERERTNFIR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattattagttaatggaagtccaaatagagagggatgtacttatacagcatta
aaggaagtaagtaaaactctagaggaaaatggaatagatactgaaatatttcaagtgggg
aataagcctataggtggatgcataggatgtggctcttgcaaaaaaacaggggaatgtttt
atgaaggattgtgtaaatgaatttgtagaaaaagctaagggtgcagatggatttgtattt
ggttcaccagtttattatgccgcagcttcaggatcaataacttcatttttagatagagca
ttttattctgggggtaagcatatggcctttaagccaggggcagttatatgtagcgcaaga
cgtgctgggacaacctctactttagatcaattgagtaagtatcttacaatatgcaatatg
ccagttgtaagttcacaatactggaatatggttcatggaaatactccagaggaggttaaa
aaggacctagaaggtatgcaaacaatgagagttctaggaagaaatatggcatggcttatt
aaatgtatagacttaggtaagaagaacaacattcttaaaccagaattagaagagagagaa
agaactaatttcatcagataa

DBGET integrated database retrieval system