KEGG   Clostridium perfringens SM101: CPR_0871Help
Entry
CPR_0871          CDS       T00379                                 

Definition
(GenBank) putative membrane protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SdpI DUF3040 DUF751
Motif
Other DBs
NCBI-ProteinID: ABG86419
UniProt: Q0SUL1
Position
1008837..1009436
Genome map
AA seq 199 aa AA seqDB search
MKKFDFTRILFFITSLLIIIGGFLVKESNLIVSIIGGLLIFALIIFDIKAPKIANLSEEN
VKIKTMRTLNRLTIFIIIIGCIFSILSPIKSSLNSKTNEILVVGLCSIFIMFFGNIAPKI
PFNRYMGLRLPWTIRDESTWKIAHRILGYVSFPIGIGMFALSFFFNIEVIVITGILIWII
IPGIYSLFFYYKKFKGVNM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttgattttacaagaatattattttttataacatcattactgataataatt
ggaggttttttagttaaagaaagtaatttaatagtttctattattggaggattgttgatt
tttgctttaattatatttgatataaaggcacctaaaattgcaaatttatcagaagagaat
gttaaaattaaaactatgagaactttaaatagacttacaatttttattataataattggt
tgtatattttctatattatctccaattaaaagttcattaaactctaaaactaatgaaatc
ttagttgttggtttatgttcaatatttattatgttctttggaaatatagctcctaaaata
cctttcaataggtatatgggattaagattaccttggacaataagggatgagagcacttgg
aagatagcccatagaatattaggatatgtatcttttcctattggaatagggatgtttgct
ttatcatttttctttaacattgaagttattgtaatcactggtattttgatttggattata
ataccaggtatatattcattatttttttattataagaaatttaaaggggtaaatatgtaa

DBGET integrated database retrieval system