KEGG   Clostridium perfringens SM101: CPR_0879Help
Entry
CPR_0879          CDS       T00379                                 

Definition
(GenBank) CAAX amino terminal protease family protein
  KO
K07052  uncharacterized protein
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPR_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abi
Motif
Other DBs
NCBI-ProteinID: ABG86166
UniProt: Q0SUK3
Position
complement(1016155..1016976)
Genome map
AA seq 273 aa AA seqDB search
MKKIIKLFQAILNIFIFLALYYILSFIGSLLFLLFCCFITKTPLRLLPPNFIDSNFFMID
GFACFLTMLVYLLIYKLKKYNKNRYINKLPRKDIPKYALISIGMGGLSALWLIFADKILS
SITLVKNSLQNFSQISESLNNEAYIFIFLSVILFGPVVEELLFRGLIFNEIDKIKGGATP
IILSSLLFGLFHREPVQVVYSSILGIILGFVYSKTRSLPLVIFMHMLNNLVATLPPPLAK
HEILQFVNGFQIISIIPMAYLLYKLHKKGSLTS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattaaactatttcaagccatactaaacatatttatttttctagcccta
tattacattctatcctttataggatctcttttatttttattattctgctgctttataaca
aagacacccttaagactattaccacctaattttattgattcaaatttctttatgattgat
ggatttgcttgttttttaaccatgttagtttatcttcttatatataaattaaagaaatac
aacaaaaatagatatattaataaacttccaagaaaagatattcctaaatacgccttaatt
tcaattggtatgggaggcctctctgctctatggctaatatttgcagacaaaatcttatcc
tctattacccttgtaaaaaatagcttgcaaaatttttctcaaatatctgaaagcttaaat
aatgaagcctatatatttatatttttatctgtaattttatttggcccagttgttgaagaa
ttactttttagaggattaatctttaacgaaatagataagataaaaggaggagcaacccct
ataattctctctagtcttttatttggattattccatagagaacctgtccaagttgtttat
tcctctatattaggaattattttaggatttgtatatagtaaaactcgttctcttccttta
gttatattcatgcatatgctaaataacctagttgcaacccttccccctccactagctaag
catgaaatactccagtttgttaatggctttcaaataataagcataattccaatggcctat
ctattatacaagctacacaaaaaaggctctttaacaagctaa

DBGET integrated database retrieval system