KEGG   Clostridium perfringens SM101: CPR_0885Help
Entry
CPR_0885          CDS       T00379                                 

Definition
(GenBank) putative lipoprotein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LprI DUF4834 tRNA_anti-like
Motif
Other DBs
NCBI-ProteinID: ABG85888
UniProt: Q0SUJ7
Position
1019599..1020375
Genome map
AA seq 258 aa AA seqDB search
MKKRNYLISLLAVVLSLGVLVGCGDKANSSNEGASVNSSENSEAASSKDSSDVAKDKGEA
DKAQAKDADSKDKEATNKDEGEKKEEDSKNDSSTKETAKVDNSNKKESKGSSNSSKKEES
KSASKKEKSNGESSLSKAKSEYLQKMQKIDSESKKLDTEYDSNRGSTQAGMNGISGEQAK
LYDDELNEIYDYLKQNLSKEKAKELEKSEMAWIKEKENKIAEIKKQYEGGSITPLMVNSE
VAKESKERCYYLIDNYMN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagaaattatttaattagtttattggctgtggtacttagtttaggagtttta
gttggctgtggagataaggcaaatagttctaatgagggggcttctgtaaatagttcagaa
aatagtgaggctgctagttcaaaagattcttctgatgtggcaaaggataagggggaagca
gataaagcacaggctaaggatgctgattctaaggataaagaagctacaaataaagatgag
ggtgaaaagaaagaagaggatagtaagaatgatagcagcactaaggagactgctaaagta
gataattctaataaaaaggaaagtaaaggatcaagtaattcttctaagaaggaagagagt
aagagtgcttctaaaaaggagaaatcaaatggtgaaagtagcttgtctaaggcaaaatca
gagtatcttcaaaagatgcaaaagatagatagtgaatctaagaagttagatacagaatat
gatagtaatagaggatcaacacaagcagggatgaatggtataagtggtgaacaggccaaa
ttatatgatgatgagctaaatgaaatttatgattacttaaaacaaaatttaagtaaggaa
aaagctaaggaacttgagaagagtgaaatggcttggattaaagaaaaagaaaacaaaata
gctgaaataaagaaacaatatgaaggtggttcaattactcctcttatggtaaattcagag
gtggcaaaggaaagtaaggaaagatgctattatttaatagataattatatgaattag

DBGET integrated database retrieval system