KEGG   Clostridium perfringens SM101: CPR_0886Help
Entry
CPR_0886          CDS       T00379                                 

Definition
(GenBank) MutS domain V protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V AAA_29 T2SSE AAA_21 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ABG87017
UniProt: Q0SUJ6
Position
complement(1020393..1022066)
Genome map
AA seq 557 aa AA seqDB search
MQLYIFIGIIIVILSVIYYNMKSKGKFIKSLNESFGHKPKDYLEDFDMTFLKNHYEIRKE
NESSGESIDELTWNDLDMDAVFKRINYTRTSLGEAYLYYKLREISYNKDEWTSLEKLITL
FTTNEELRNKVSLLLLKVGKLIDLNLTNFIYNPKFSKIPSYYKYPLLSLGFIFSIFLSFI
YTKVGLILSFIFLCINILSYQSEKIFLEDRFKVMIYLLNNINLCISLSKIKDKDFEFFKN
EVNSALHNFKALNIVKIYGNSFQKKKNAFTDIDIIFDYIKMFFMVDIIAYQNSVKILEKN
KENLYKIYDIVAKLDFALSLAYYRKSLSEYTIPEFIKSDDISLENLYHPLIDNPVKNSIL
IKNNILFTGSNASGKSTFIKAVALNCILAQSLNTALCSKYRCKFSKVVTSMAIKDNILAG
DSYFIAEIKSLKRLLDSLNGEIRVLAFIDEILKGTNTIERISASVSILKYAENTNGKLLV
ATHDMELTQILETYENYHFSETVTENGVTFDYKLKKGPSNTRNALKLLKAMNFNKDVVSL
SNQVYNNFIETEKWGKL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcaattatatatttttattggaataatcatagttattttatctgtgatttattacaac
atgaaatccaaaggtaagtttattaaaagcttaaatgaaagttttgggcacaagcctaag
gattatcttgaagattttgatatgacctttctaaaaaatcactatgaaattcgtaaggaa
aatgaatcctctggtgaatcaattgatgagctaacttggaatgacctagatatggatgca
gtctttaagcgtataaactacacaaggacaagcttaggggaagcttatttatactataaa
cttagagaaattagttacaataaagatgagtggacaagcttagaaaaacttataacccta
ttcaccaccaatgaagaattaagaaataaagtatcactgcttttactgaaagtaggaaag
ttaattgaccttaacttaactaatttcatttataatcctaagtttagcaaaatacctagt
tattataaataccccttattatctttaggttttatattttcaatattcttatcctttatt
tacacaaaggttggtcttatacttagctttatctttctatgcataaatatattatcatac
caaagtgaaaaaatatttttggaagataggtttaaagttatgatttatctattaaataat
attaatctttgtataagtctctctaaaattaaggataaggattttgagttttttaaaaat
gaagtaaactctgcccttcataacttcaaagctttaaatatagttaaaatttatggtaat
agctttcaaaagaagaaaaatgcctttactgatattgatattatttttgattacataaag
atgttttttatggtggatattatagcttaccaaaactcagttaaaatcttagagaaaaac
aaggagaatctttataagatatatgatatagtggccaagttagattttgccttaagcctt
gcttactatagaaaaagtctaagtgaatacactatcccagaatttattaaaagtgatgat
ataagtctagaaaatctataccatcctcttattgataatcctgttaaaaactccatactt
ataaagaataatattctctttacagggtcaaatgcttctggtaagtctacctttataaaa
gcagtagctctaaactgcatacttgcccaaagtttaaacactgccttatgttcaaaatat
agatgcaagttttctaaggtggtaacctctatggcaataaaagataatatactagctggg
gatagctacttcattgcagaaataaaaagtttaaaaaggctccttgactctttaaatgga
gaaattagagttttagcctttattgatgaaatattaaaaggtacaaacaccatagagaga
atctcagcctcagtctccatattaaaatatgctgaaaacaccaatggaaaattgctagta
gccactcatgatatggaattaactcaaatccttgaaacctatgaaaactatcactttagt
gaaactgttacagaaaatggagtaacttttgattacaaactaaaaaaaggaccttccaat
acaagaaatgccctaaaactccttaaagcaatgaactttaataaggacgtagtttcctta
tcaaaccaagtatataataatttcatagaaactgaaaaatggggaaagctttaa

DBGET integrated database retrieval system