KEGG   Clostridium perfringens SM101: CPR_0887Help
Entry
CPR_0887          CDS       T00379                                 

Definition
(GenBank) hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM_GPCR_Srw Ac76 DUF1154
Motif
Other DBs
NCBI-ProteinID: ABG86793
UniProt: Q0SUJ5
Position
1022237..1022539
Genome map
AA seq 100 aa AA seqDB search
MKEFFWDILPSIVLVIIFVIVLNDFRNNKNLKRNKRYSKESDDINKKEGKRVDYMSIGMW
VGVAISIFFIRKFGSIVITYGALCGLLVGKFVGVIVKRNF
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtttttttgggatattttgccctctatagtacttgtaattattttcgttata
gttttaaatgattttaggaataataaaaatttaaaaaggaataaaagatattctaaagaa
tcagatgatataaataagaaagaaggaaaaagagtagattatatgtctattggaatgtgg
gttggagtagcaataagcatattttttataagaaaatttggatcaattgttattacttat
ggagctctgtgtggactgttagttggaaagtttgtgggagtaatagttaaaagaaatttt
taa

DBGET integrated database retrieval system