KEGG   Clostridium perfringens SM101: CPR_0890Help
Entry
CPR_0890          CDS       T00379                                 

Definition
(GenBank) Hypothetical protein, CF-32 family
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABG85958
UniProt: Q0SUJ2
Position
1024635..1024958
Genome map
AA seq 107 aa AA seqDB search
MKDQKHLESKKYLQVKSFYKVKISISKNGIYHINHINSLHSKLKIWMYRFKGVSSKVLSN
YMAWYKWLESFNDDKEIIRTKNMIIHSVIPFVDTKIKGYKYREITFI
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcaaaaacatctagaaagcaaaaagtatcttcaagttaaatccttctataaa
gtaaaaatatccataagtaaaaatggtatataccatatcaatcacatcaattctttgcat
agtaaactaaagatttggatgtatagatttaaaggtgtatcaagtaaggttttatcaaat
tatatggcgtggtacaagtggcttgaaagttttaatgatgataaagaaatcattagaaca
aagaatatgataatacacagtgtaataccttttgtagatactaaaattaaaggatataaa
tatagagaaataacatttatataa

DBGET integrated database retrieval system