KEGG   Clostridium perfringens SM101: CPR_0893Help
Entry
CPR_0893          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3784 Tetraspannin DUF2244
Motif
Other DBs
NCBI-ProteinID: ABG86512
UniProt: Q0SUI9
Position
complement(1027925..1028173)
Genome map
AA seq 82 aa AA seqDB search
MVKKKTSLIHHYHLRGVKDIKNYCSFMGGCLFLLGVVFIGFSILGFTEILTFAQMQLSIF
ILCILDVVALFVIQEKFAGHIF
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaaaaacaagcttaatacaccattatcacctaaggggagtaaaggacatt
aaaaattattgtagctttatgggaggatgtttattccttttaggcgtagtatttataggc
ttttctattttaggctttactgaaattttaacttttgcacaaatgcaacttagtatattt
attctttgtattttagatgttgtggcactttttgttatacaggaaaagtttgcagggcat
atattttag

DBGET integrated database retrieval system