KEGG   Clostridium perfringens SM101: CPR_0895Help
Entry
CPR_0895          CDS       T00379                                 

Definition
(GenBank) hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M78
Motif
Other DBs
NCBI-ProteinID: ABG87520
UniProt: Q0SUI7
Position
1029729..1030547
Genome map
AA seq 272 aa AA seqDB search
MNFIDTYDEILSYFSSKEFNISLWENYSNVISKELSNKVKRDIKDYNYRKDILPVVETAL
KSREKLKQVHESFIAVSDNIKYKFNELFEEDLDLDIILYLGLCNGAGWATSLDNKNVVLL
GIEKIIELDWCNEEDMFALIAHEIGHIWHKTKGGCFGKQKNISEKALFQLYSEGVAMLFE
QLLCGDENYYHQNQEGWIDWCENNLIELKREYLIRITNSESVQDFFGDWNSYKGHSDVGY
FIGCKFVRFLLKKIFTYRNAFYGNGFNVKRIY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatagatacatatgatgaaattttatcttatttttcatcaaaggaatttaat
atatcactttgggaaaattattcaaatgtgatttcaaaggaattatctaataaagttaaa
agggatattaaagattataattacagaaaggatatattgcctgtagttgaaacagctcta
aaaagtagggaaaaattaaagcaagtccatgaatcatttatagcagtttcagataatata
aaatataaattcaatgaattatttgaagaagatttggatttagacattattctatactta
ggtctatgtaatggagctggctgggcaacatcacttgataataagaatgttgttctactt
ggaattgaaaagattattgaacttgattggtgtaacgaagaggatatgtttgctttgata
gctcatgaaataggtcatatttggcataaaactaagggtggatgttttggaaaacaaaaa
aatattagtgaaaaagcactttttcaactttatagcgaaggagtagctatgttatttgag
caattactatgtggagatgaaaattattatcatcaaaatcaagagggatggatagattgg
tgtgaaaataatttaattgaactaaagagagaatacttaataagaattactaattctgaa
agtgtacaagacttttttggagattggaatagttacaaaggtcattcagatgtaggctat
tttataggatgtaaatttgttagatttcttctaaaaaaaatattcacttacagaaatgct
ttctatggaaatggatttaatgttaaaagaatatattag

DBGET integrated database retrieval system