KEGG   Clostridium perfringens SM101: CPR_0903Help
Entry
CPR_0903          CDS       T00379                                 

Definition
(GenBank) putative ribose operon repressor
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_4 LacI Peripla_BP_1 HTH_3 TetR_N HTH_36 HTH_26 HTH_38 Trp_repressor HTH_11 HTH_7 HTH_Tnp_ISL3 HTH_5
Motif
Other DBs
NCBI-ProteinID: ABG86364
UniProt: Q0SUI0
Position
complement(1034819..1035838)
Genome map
AA seq 339 aa AA seqDB search
MKKNITFSDIAKYTNFSKTTISRYFNSPETLTQASIQKIEKALSELNYTENKVARSLANG
KTEIIGIIIPNLFLHYYSQILNNIIDTYSKYNYKFLVFLGNSDPNEEIKYIKELMAYKIE
ALIILSHSISSHQLKEFNIPIVAIEREDNYISSVNSDNYSGAEKATKLLIENNCDILIHI
NGKINGNTPAYKRIEAFKETCQRNNQDFKIYMSNIKSSFEESYNSLYQIYLDIEKNYPYV
KKGVFLSNDTHANIFLNILIRNKKSIPDEYELIGFDNSPISTEAIIPITTIGQNIDKISD
YAIKSLLRQINLKKNNKIAPIEHIVVPTELIVRDTTSKY
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaacatcacttttagtgatatagctaaatatacaaatttttctaagacaaca
atatcaagatattttaattctccagaaactttgactcaagcttcaatacaaaaaattgaa
aaagcattatcagaattaaattatactgaaaataaagttgccagaagtttagcaaatggt
aaaactgaaattataggaattattatccctaacttatttcttcactattattctcaaata
ttaaataatataatagatacctatagtaaatataattataaatttttagtattcttagga
aattctgatccaaatgaagaaataaaatatataaaggaactaatggcttataaaattgaa
gcgcttataatattaagtcattctataagttcacatcaattaaaagaatttaatattcca
attgtagccatagaacgcgaagacaattatatatcaagtgtaaatagtgataattattct
ggtgctgaaaaagcaactaaattactaattgagaataactgtgatatattaatacatata
aatggaaaaataaatggcaatactcctgcttacaagcgtattgaagcatttaaagaaact
tgccaaaggaataatcaggattttaagatttatatgtcaaacattaaaagttcttttgag
gaaagctataattctctttatcaaatttatttagatattgagaaaaattatccttatgta
aaaaaaggagtatttctaagtaatgatacacatgcaaatatctttctaaatattcttata
agaaataaaaaaagtataccagacgaatacgaactaataggatttgataattctccaatt
tctactgaagcaataattcctataacaacaataggtcaaaatattgataaaatatctgac
tatgctataaagtctctattaagacaaataaaccttaaaaaaaataataaaattgcacct
attgagcatattgttgtaccaactgaattaatagttagagatactacaagtaagtattaa

DBGET integrated database retrieval system