KEGG   Clostridium perfringens SM101: CPR_0905Help
Entry
CPR_0905          CDS       T00379                                 

Gene name
msmF
Definition
(GenBank) transmembrane permease MsmF
  KO
K10121  fructooligosaccharide transport system permease protein
Organism
cpr  Clostridium perfringens SM101
Module
cpr_M00197  Putative fructooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpr02000]
    CPR_0905 (msmF)
Transporters [BR:cpr02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative fructooligosaccharide transporter [MD:M00197] [OT]
    CPR_0905 (msmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABG87817
UniProt: Q0SUH8
Position
1037412..1038281
Genome map
AA seq 289 aa AA seqDB search
MNKIREKIMGMAFFGPALVLLTLFLFIPMILTLIFSFTDFFTLNPSATKFVGLRNYTRLF
NDELFGKAFFNTIKFALVVVPLQMGGALLLALGINKVTHCKKYFKIAFFIPVVMSLAVVS
TLWMQIYSPEGILNNMLNAIGISSQPFIFSKDQALNSISALSIWQGMGYQMIIFLGGLQA
ISPSLYEAAEIDNASGWGKFWNVTVPELKPISIYILLTITIGAFKLLVQPMVMTGGGPAF
STYSLVYYIYDTGTVNWDMGYSSAMAIVFAIIVIALAGIQYKLTNKKED
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataagagaaaagataatgggaatggctttttttggcccagcattagtgtta
ctaacattatttttgtttattcctatgattttaactttgatatttagttttacagacttt
tttacattaaatcctagcgcaactaagtttgttggacttagaaattatacaagattattt
aacgatgagttatttggaaaagcattttttaatacaataaaatttgcacttgtagttgta
ccattgcagatgggaggagcattacttttagcacttggcataaataaagttactcattgt
aaaaaatatttcaaaatagcattttttattccagtagtaatgtcacttgcagtagtatca
actttgtggatgcagatttatagccctgaaggtatattaaataatatgttaaatgctatt
ggaatatcatctcagccatttatattcagtaaagatcaagcacttaattctatatcagca
ttaagtatatggcaaggaatgggatatcagatgattatatttctaggtggcttgcaggct
atttctcctagtttatatgaagcagcagaaattgataatgcaagtggatggggcaaattt
tggaatgtaacagttccagagcttaaaccaatttcaatatatatattattaacaattaca
ataggagcatttaaattattagttcagcctatggtgatgacaggaggaggaccagccttc
tctacatattcacttgtgtactatatctatgatactggtacagttaattgggatatggga
tattcttcagcaatggcaattgtatttgcaattatagtaattgcacttgcaggtattcaa
tataaacttacaaacaaaaaggaggattaa

DBGET integrated database retrieval system