KEGG   Clostridium perfringens SM101: CPR_0923Help
Entry
CPR_0923          CDS       T00379                                 

Definition
(GenBank) radical SAM domain protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg
Motif
Other DBs
NCBI-ProteinID: ABG85334
UniProt: Q0SUG0
Position
complement(1059069..1059302)
Genome map
AA seq 77 aa AA seqDB search
MASFNKQYNGKFIFEITIVKGYNDDPESVNKLKEVIKTICPNEVIVARIDDDIFKKKLGI
SDERFEEISRELLNVNC
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctttaataaacaatataatggaaaattcatatttgaaataaccatagttaag
ggatataatgatgatcctgaatcagttaataaactgaaggaagttataaaaacaatctgc
cctaatgaggttattgttgctagaattgatgatgatatatttaagaaaaaacttggtata
tctgatgaaagatttgaggaaatttcaagggagctattaaatgtaaactgctaa

DBGET integrated database retrieval system