KEGG   Clostridium perfringens SM101: CPR_0925Help
Entry
CPR_0925          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABG86051
UniProt: Q0SUF8
Position
complement(1059785..1059958)
Genome map
AA seq 57 aa AA seqDB search
MLTEDTKNAFLCIELVDENREKEFENALKELSQLVEKNLGGKSEVSILHINNKEAII
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagaagacacaaaaaatgctttcttatgcattgagttagttgatgaaaataga
gaaaaagaatttgaaaatgccttaaaagagttatctcaattagtagagaaaaacttaggt
ggaaaatctgaggtttcaatacttcatattaataataaggaagctataatttaa

DBGET integrated database retrieval system