KEGG   Clostridium perfringens SM101: CPR_0929Help
Entry
CPR_0929          CDS       T00379                                 

Definition
(GenBank) ISCpe7, transposase
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS1 Zn-ribbon_8 Zn_Tnp_IS1595 PhnA_Zn_Ribbon TF_Zn_Ribbon zf-C2HC_2 ICAT OrfB_Zn_ribbon zf-ISL3 TFIIS_C HypA
Motif
Other DBs
NCBI-ProteinID: ABG86936
UniProt: Q0SUF4
Position
1063612..1064172
Genome map
AA seq 186 aa AA seqDB search
MNKTNIKCPRCHSKKLYKFGFDKQANQKYQCKECGRQFAPDSVSSRPKSKYPRCPKCNKG
TYLHHKYKHYNRYKCGSRKCNHAFSQYHNLNIDLASSENLTGSLSMKGMRFPLHTILTAL
TLYFLNNTSTRAISQFLKVTSNISVSHVTISSWVHKFAPYFKEKAKIFNSQLDLNLDDWH
ADVWYS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaactaatataaaatgccctcgttgtcattcgaaaaaactatataagtttgga
tttgacaagcaggctaatcaaaaatatcaatgtaaagaatgtggtagacaattcgcgcct
gactccgtcagtagccgtccaaagtctaagtaccctagatgtcctaaatgtaataaaggc
acatatcttcaccataaatacaaacactataatcgttataaatgtggaagcagaaagtgt
aatcatgctttctctcaatatcacaatttaaatatagatttagcttcaagtgagaattta
accgggtccctttctatgaaaggaatgcgttttccactacatacaatacttacagcttta
accttgtattttttaaataatacttcaactagagcaatttctcaatttttaaaagtaaca
tctaatatctcggtttcacatgttactatctctagttgggtacataaatttgcaccttat
tttaaagaaaaagctaagatatttaactctcaactagatttaaatttagatgattggcat
gctgatgtgtggtattcataa

DBGET integrated database retrieval system