KEGG   Clostridium perfringens SM101: CPR_0930Help
Entry
CPR_0930          CDS       T00379                                 

Definition
(GenBank) ISCpe7, transposase
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS240 rve_3 rve DDE_Tnp_ISL3 DDE_Tnp_IS1595 Pox_VLTF3 MULE rve_2 DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ABG87331
UniProt: Q0SUF3
Position
1064160..1064630
Genome map
AA seq 156 aa AA seqDB search
MVFINGKKYYLWLAIDSETRFVLAFHLTQARDSDAAFILMNQAKSMGKPKHFITDRLPSY
NEAVKTVLNESTHIPVPPMSSDTNNNLIESFNKTFKAWYKAKKGFNSFEKANNLIYMFIF
HYNFIRPHGSLNGSTPAEVAGFSTNDSSKHNWFIAA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtggtattcataaacggtaaaaagtattatttatggcttgctatagactctgaaacacgt
tttgtattagcttttcatctaacacaagcacgtgattctgatgcagcatttattcttatg
aatcaagctaaatctatgggtaaacctaagcactttatcacagatagactaccgtcctat
aatgaagcagttaaaaccgtattaaacgaaagcactcatattcctgtaccacctatgtct
agtgatacaaataataacttaatagagtctttcaataaaacatttaaagcatggtataaa
gctaaaaaaggttttaattcttttgaaaaagctaataacttaatatacatgtttatattt
cactataatttcattagacctcatggatcattaaacggctctacgcctgccgaagtagcc
ggttttagtactaatgattctagtaaacataattggtttattgctgcttaa

DBGET integrated database retrieval system