KEGG   Clostridium perfringens SM101: CPR_0956Help
Entry
CPR_0956          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09153  uncharacterized protein
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPR_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2304 DUF2878 LapA_dom SLAC1 DivIC CitMHS
Motif
Other DBs
NCBI-ProteinID: ABG87039
UniProt: Q0SUC8
Position
complement(1087431..1087763)
Genome map
AA seq 110 aa AA seqDB search
MYWYCVIIALIFLILTIVFIKKRLLDIRYTLVWFIAGISMLLLSLNSGILNYFSKILNII
YPPSLLFLIGILFCFILILSLIVTITSLQIKLTRLTQEIALLKNEKENKE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtattggtattgcgttataatagcattaatatttttaattttgacaatagtatttata
aaaaaacgattattagacataagatacactttagtttggtttattgctggaataagcatg
cttttattatcattaaatagtggtattttaaattatttttcaaaaatactaaatataatc
tatccaccatcattgttatttttaattggaattttattttgttttatattaattttaagt
ttaatagttacaataacatccttacagattaaacttactagacttacacaagaaattgct
ttactaaaaaatgaaaaggagaacaaagaatga

DBGET integrated database retrieval system