KEGG   Clostridium perfringens SM101: CPR_0984Help
Entry
CPR_0984          CDS       T00379                                 

Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase family protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 NAD_binding_8 DAO Thi4 3HCDH_N TrkA_N 2-Hacid_dh_C FAD_binding_3 NAD_binding_7 UDPG_MGDP_dh_N XdhC_C
Motif
Other DBs
NCBI-ProteinID: ABG86198
UniProt: Q0SUA0
Position
1121612..1122985
Genome map
AA seq 457 aa AA seqDB search
MNKYEYIIIGFGKGGKTLAGYLGKLGKKVAIIEKSDKMYGGTCINVGCIPTKTLVNKSKV
SLYKGLNTFEEKAREYRKSIEEKNALIEALRDKNYNMLNNNENVDVFNGTASFISNTEIL
INSEKEDIILEGEKIFINTGATTIIPNIQGIKSSSKIYNSTTIMELKELPKHLVIVGGGY
IGLEFASIYASFGSKVTVIEAFDRIAGREDEDISKSIKEILEKKGIEFLLGSKVKSFEEI
HGEVEVSYENSLGELNKITGDAVLIAIGRKPNTEELNLEAAGVKVTERGAIEVNNKLKTN
IPNIWAIGDVNGGPQFTYISLDDFRIIKDNLFGEGKRSTDDRKFIPYSVFIEPNLSRVGL
SEKEALEKGFEIKTAKLDVNTIPRAKVIGETEGIMKAIVDVKTNKILGCTLLCAESAEII
NIVTLAMKADEDYTFLRDNIFTHPTMSEALNDLFSLI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatgaatatattataataggatttggaaaaggtgggaaaacacttgctggt
tacttaggaaaactaggtaaaaaggttgctataatagaaaaatcagataagatgtatggt
ggaacatgtataaatgttggatgtattcctacaaaaactttagtaaataaatcaaaagta
tccttatataaagggttaaatacctttgaagaaaaagcaagagagtatagaaaatctata
gaagaaaaaaatgctttaatagaagctttaagggataaaaattataatatgctaaataat
aatgaaaatgtagatgtatttaacggaacagcttcatttatatcaaatacagaaatactt
attaatagtgaaaaagaagatataattttagagggagaaaaaatcttcataaatacagga
gctactactataattcctaatatacaaggaataaaaagtagcagtaaaatatataacagt
actacaataatggaattaaaagaattaccaaaacatttagttatagttggtggtggatat
attggattagaatttgcatcaatttatgcaagttttggctcaaaagtaacagtaatagag
gcctttgatagaattgctggcagagaagatgaggatatttctaaaagtataaaagaaatt
ctagagaaaaaaggaattgaattcttattaggatcaaaagttaaatcttttgaagaaata
catggagaagttgaagtttcttatgaaaatagcttaggagagttaaataaaattacagga
gatgcagttttaatagctataggtagaaaaccaaatactgaagaattaaatttagaggct
gcaggtgttaaagtaacagagaggggagctatagaagttaataataaactaaaaacaaat
atccctaatatctgggctattggagatgttaatggtggtcctcaatttacatatatatct
ttagatgattttagaattataaaagacaatttatttggagaaggaaagagaagtactgat
gatagaaaatttattccatactcagtatttattgaaccaaacttatctagagttggatta
agtgaaaaagaagctttagaaaaaggctttgaaataaaaactgctaaattagatgttaat
actattccaagggcaaaggttattggagaaactgaaggaattatgaaagctatagtagat
gtaaagacaaacaagatattaggttgcacacttttatgtgcagaatcagctgaaataata
aatatagttaccttagccatgaaagctgatgaggattacactttcttaagagataatata
tttactcatccaactatgagtgaggctttaaatgatttattctcattaatttag

DBGET integrated database retrieval system