KEGG   Clostridium perfringens SM101: CPR_0985Help
Entry
CPR_0985          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTXphi_pIII-N1
Motif
Other DBs
NCBI-ProteinID: ABG85595
UniProt: Q0SU99
Position
complement(1123350..1124597)
Genome map
AA seq 415 aa AA seqDB search
MNPFLEKSSKIQDYFTDWRNIYAKPYNKNEVDPYTKTRIILMNGAEFEANWFSHQFSRNC
NNNELRREIALARRLDKQQQMLISSLRPANESILETTISYEQLAVDLTARLAKREPNEHV
KKALDFALLEDFDHLYRYSDLLFMEEGTKAENLVGHYTEIMPGRPTIAHHRCPNDNIRNF
VDFKTADLITKLDISIITAAEQQTMNYYMNIAGFYTSDIGRNLYQEIGLIEEQHVSHYGS
LLDPNCTWLENLLMHKYTEAYLYYSCYNSEVDPYIKGLWEQCFVQEVTQLHKACDLLKKY
ENKEWQEVIPNGEFPELLTLGENISYVRDILDNTVNNTTIKDDYVDVSKLGPDSSFHEFQ
NKVNKNVEDVPSHKVIVDFISKNNEDYRFETKENPILALRDRKSDNTSIGRTSLS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttttagaaaaaagctcaaaaatacaagattattttacagactggagaaat
atttacgcaaaaccttataataaaaacgaagttgatccttatacaaaaactagaataatt
ttaatgaatggagctgaatttgaagcaaactggttttctcatcaattctctagaaattgt
aataacaatgaacttagaagagaaattgcccttgctagaagattagataaacaacaacaa
atgctaattagttcactaagacctgctaatgaaagtattttagaaactactataagttat
gaacaactagctgtagatttaactgctagacttgcaaagcgtgaacctaatgaacatgtt
aaaaaagctttagattttgcattacttgaggattttgaccatttatatagatattcagat
ttattatttatggaagaaggaacaaaagcagaaaatctagttggacattatacagaaatt
atgccaggtagaccaactattgctcatcatagatgccctaatgataacataagaaacttt
gttgactttaaaacagcagaccttattactaaactagatatatcaataattactgcggca
gaacaacaaactatgaattattacatgaatatagcaggtttctatactagtgatattgga
agaaatctttatcaagaaataggattaatagaagaacaacacgtttctcactatggaagt
cttttagatcctaactgtacatggcttgaaaatctacttatgcataaatacactgaagca
tatttgtattattcttgttataattctgaagttgatccatatattaaaggactatgggaa
caatgcttcgttcaggaagttactcaattacataaagcttgtgatcttcttaaaaaatat
gaaaataaagaatggcaagaagttattccaaatggtgaattcccagaacttctaacactt
ggagaaaatatatcttatgttagagatatattagataatactgttaataatacaactata
aaagatgattacgttgatgtaagtaaattaggtcctgattcatcattccatgaattccaa
aataaagttaataaaaatgttgaagatgttccaagtcataaggtcatagttgattttatt
tcaaaaaataatgaagattatagatttgaaacaaaagaaaatccaattcttgctttaaga
gatagaaaatctgataatacttctattggaagaacatctttaagttag

DBGET integrated database retrieval system