KEGG   Clostridium perfringens SM101: CPR_0986Help
Entry
CPR_0986          CDS       T00379                                 

Definition
(GenBank) putative helicase
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N SNF2_assoc Helicase_C ResIII ERCC3_RAD25_C SWIM AAA_11
Motif
Other DBs
NCBI-ProteinID: ABG87267
UniProt: Q0SU98
Position
1124716..1127925
Genome map
AA seq 1069 aa AA seqDB search
MPLNLDIFMKNLVRRTSSFTREQGKKLIKEAYVKDVKGKSIDGIYHIYGSVLNDDKNWDY
NTHIKINMQNSDIMGTNCSCETFKENSKHIKNYVCKHISATNDVFYSLAKKKMQKNKLKS
NNKPKLVKEKNEEHKGQEKRFLSLDINIKHMLKEGITLFNCEFRIGTGNLNLILDLKDFL
YKNSLKKPLKFNDGFTYNPLKDEFLDEDKRVLQFVASHKDMISGRYLRLKQNNLKDFLKL
IDEKKKINFNFNSINYEVKVKKENVPVALTLKEGKEGFILSHHKKFPIILNNSGDVMFFD
RNLYLPRKRQLEYYIPIHKLFLKNNTITYKKSLENLRSLLEELKNISKNIVLDENIRVFK
EKLMKTTFNLYKNKEKVYCNVKIDYCGYIIDLIRDEKDNSFLRDLKSEKYIEFQLERFKF
IKREEDFCFIGSEEEIYELLSKGIKKLKELGEVLLSEELKAFKVLDSSFISSELIELSNF
YKLKFDFGNFELRELMESIEAMKRGDHFYRTNKVYLDLEDPGIVNFLNLLDDLGLENIKD
NEVYIDKSKVLYIQEKLKDRNLSFIKGGNVLQEIVGKLLNKEFKRKLVPKALNAELRPYQ
KEGFKWINEITDLGFGGVLADDMGLGKTLQIIAFLLSQKKSKSIVVVPTSVIYNWMDEFE
KFAPSIRVGLVHGSKSKRDKVLRDFKRGLGIKIEEKNLKEKSYEKYDVLLTTYGTLKNDE
KAYENLSFDYCIIDEAQNIKNPSAQATLSVKNIKSRCNIALTGTPIENNLMELWSIFDFV
MPGYLFTKERFRERFILDESNLSELKSLITPFILRRLKEEVLSELPEKLEKKYLVEMKGK
QKQLYSFYVNAIKNQLNENKSSEKSGRDKINLFAYLTKLREICLDPSLVVPDYKGGSSKL
TVVKEIVKDASESGKKILLFSQFTSVLQKIEEDFKKEDISYLYLDGGTSAKDRVERVKKF
NEDSNIKVFLISLKAGGVGLNLTSASVVIHFDPWWNPAVEDQATDRAHRFGQENKVEVIK
LVAKDTIEEKIVLMQEDKRELIQSLMDGKTMDGKGLKRLTEEEISKLFE
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaacttagatatttttatgaagaacttagtaaggcgaacttccagttttact
agagaacaaggtaaaaagttaattaaggaagcatatgttaaagatgttaagggtaagagc
atagatggaatttatcatatttatggaagtgtattaaatgatgataaaaactgggattat
aatacacacataaaaataaatatgcaaaatagtgatattatgggtactaattgtagttgt
gaaacctttaaagagaatagtaaacatataaaaaattatgtgtgcaaacacatttcagca
actaatgatgttttttattccttagcaaagaagaagatgcaaaagaataaattaaaaagt
aataataagcctaaattagttaaagagaaaaatgaggaacataaagggcaagaaaagagg
tttttatctttagatataaatattaaacacatgttaaaagagggaattactttatttaac
tgtgagtttagaattggtacaggaaacttaaatttaatactggatttaaaagatttctta
tataaaaatagcttaaaaaagcctttaaaatttaatgatggatttacttataatccatta
aaagatgaatttttagatgaagataaaagagttcttcaatttgtagcaagccataaggat
atgataagtggaagatatttaagacttaaacaaaataatctaaaagatttcctaaaatta
attgatgaaaaaaagaaaataaattttaattttaactcaattaattatgaggttaaggtg
aaaaaggaaaatgttccagtagctctgactttaaaggaaggtaaagagggatttatatta
agtcaccataagaaatttcctattattttaaataactcaggagatgtaatgttttttgat
agaaatttatatcttccaaggaagaggcagttagaatattacattccaattcacaagtta
tttttgaaaaataacacaatcacatataagaagagcttagagaatttaagaagtctatta
gaagaacttaaaaacataagcaagaatatagttctagatgaaaatattagagtttttaaa
gaaaagcttatgaaaacaacctttaatttatataaaaataaggaaaaagtttattgtaat
gtaaagattgattattgtggatacataattgatttaataagagatgaaaaagataatagc
tttttaagagatttaaaaagtgagaagtatatagaatttcaacttgaaagatttaagttc
ataaagagagaagaagatttttgctttataggaagtgaagaggaaatatatgagctttta
tctaagggaattaaaaaactaaaagaacttggagaagttttattatcagaggaacttaag
gcgtttaaggttttagattcatcatttatttcatcagaacttatagaacttagtaatttt
tataagcttaagtttgactttggaaattttgaattaagagaacttatggaaagcatagag
gctatgaaaaggggagaccacttttatagaactaataaggtttatttagatttagaagat
cctggcatagtaaactttctaaatcttctagatgatttaggattagaaaatataaaagat
aatgaagtctatatagataagagcaaggttttatatattcaagaaaaattaaaggataga
aatctctcttttataaaagggggaaatgttcttcaagaaatagtaggaaagcttctaaat
aaagaatttaagagaaagcttgttccaaaggctttaaatgcagagcttagaccttatcaa
aaagagggatttaaatggattaatgaaattactgatttaggttttggtggagttttagca
gatgatatgggacttggtaaaacccttcaaataatagcttttttattatctcagaaaaaa
agcaaaagcatagtagttgtcccaacatctgttatatataactggatggatgagtttgaa
aagtttgctccaagcataagagttggattagttcacggtagtaaatctaagagggataag
gttttaagggattttaaaagaggacttggtattaagatagaagagaagaatttaaaagaa
aaatcctatgaaaaatatgatgttttattaactacctatggaaccttaaagaatgatgaa
aaagcctatgaaaacttaagttttgattattgcataatagatgaggctcagaatataaag
aatccatcagcacaagcaactttatctgttaaaaatattaaatcaagatgcaatattgcc
ttaacaggaactcctatagagaataatttaatggagctttggtcaatatttgattttgtt
atgcctggatatttatttactaaggagagatttagagaaagatttattttagatgaaagc
aatttaagtgaattaaaatccttaataactccttttattttaagaagacttaaggaagag
gttttaagtgaacttccagaaaaacttgagaaaaaatacttagtagaaatgaaaggaaaa
caaaaacagttatatagcttctatgtaaatgcaataaagaatcaattaaatgaaaataaa
agttctgaaaagagtggaagagacaaaattaatctatttgcctatttgacaaaattaaga
gaaatttgtttagatccttcactagttgtaccagattacaagggaggaagtagtaagctt
actgtggtaaaagaaattgtaaaagatgctagtgaatcaggaaagaagattttactattc
tctcaatttacttcagtactacaaaaaatagaagaggactttaaaaaagaggatatttct
tatttatatttagatggaggaacttctgctaaggatagagtagagagagttaaaaaattc
aatgaggatagtaatattaaagtgtttttaatatccctaaaggctgggggagttggacta
aatttaacctctgccagtgtggttatacattttgatccttggtggaatccagccgtagaa
gaccaagctacagatagagcacatagatttggacaagaaaataaagttgaagttataaag
ttagttgcaaaggatactattgaggaaaaaatagtattaatgcaggaggataaaagagaa
cttattcaaagtttaatggatggaaaaactatggatggtaagggattaaaacgacttaca
gaagaagaaattagtaaattatttgagtag

DBGET integrated database retrieval system