KEGG   Clostridium perfringens SM101: CPR_0987Help
Entry
CPR_0987          CDS       T00379                                 

Definition
(GenBank) RNA pseudouridine synthase family protein
  KO
K06182  23S rRNA pseudouridine2604 synthase [EC:5.4.99.21]
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cpr03009]
    CPR_0987
Enzymes [BR:cpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.21  23S rRNA pseudouridine2604 synthase
     CPR_0987
Ribosome biogenesis [BR:cpr03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    CPR_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ABG86700
UniProt: Q0SU97
Position
1128406..1129092
Genome map
AA seq 228 aa AA seqDB search
MRINKLFSNFGICSRKETNKIIREGRVIVNGKPCIEGQWVELSDEILLDGKPLVPKEKIY
IALNKPVGVVCTAAEEVKDNIIDYLGIDDYVFPIGRLDKDSQGLIILTNDGDLANEVLAA
ENNHEKEYIVTLDQPFYDDFIEKMEQGVEILGQVTKPCKLKRINENTYSIILTQGLNRQI
RRMSKVFGFNVVKLERIRILNITIDNIEYGKWRYINRKEIEILKKLIK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagaataaacaagctttttagcaattttgggatatgctctagaaaagaaactaataaa
attattagagagggaagagttattgttaatggcaagccgtgtattgaagggcaatgggtt
gaattaagtgatgaaatacttttagatggaaaacccttagttccaaaggaaaagatttat
atagcacttaataagcctgtaggagttgtgtgtactgctgcagaagaagttaaggataat
ataatagattatttagggatagatgattatgttttcccaataggaaggctagataaggac
tctcaaggattaataattttaactaatgatggagatttagcaaatgaagttttagcagca
gaaaataaccatgaaaaggaatatatagtaaccttagatcaacctttttatgatgatttt
attgaaaagatggagcagggtgttgaaatattaggacaagtaacaaaaccttgtaaacta
aagagaataaatgaaaatacctattcaataatattaactcaagggttaaatagacaaata
agaagaatgagtaaggtttttggctttaatgtagttaagctagagagaattagaattcta
aatataactattgataatatagaatatggaaagtggagatatataaataggaaagaaatt
gagattttaaaaaaacttataaagtag

DBGET integrated database retrieval system