KEGG   Clostridium perfringens SM101: CPR_0991Help
Entry
CPR_0991          CDS       T00379                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K22605  3alpha-hydroxycholanate dehydrogenase (NADP+) [EC:1.1.1.392]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    CPR_0991
Enzymes [BR:cpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.392  3alpha-hydroxycholanate dehydrogenase (NADP+)
     CPR_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Glyco_tran_WecB DFP Polysacc_synt_2 OmpH NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABG85886
UniProt: Q0SU93
Position
1131543..1132304
Genome map
AA seq 253 aa AA seqDB search
MDILSKSIKNKVVIVTGGTRGIGFATVKKFLDHGAKVALCGSRKETVDKALEELNYINPN
YDAIGFYPNLLDSNEVKEMVDKVLEKWGTIDILINNAGVSDNKSIYTQSDEDFSKIIDIN
VKAIFNCTKAVSEIMKNKKYGVILNTSSVVSLYGQKTGVGYPTSKFAVNGLTKSLARELG
RDGIRVNAVAPGIIATDMVAALDKKLVDQIAQNVPLGRVGEPEDIANAFLFLASDMASYI
SGEILSVDGSVVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatattttatcaaaaagcataaaaaataaggtggttatagtaacaggtggtactaga
ggaataggatttgctactgtgaaaaaatttctagaccatggtgctaaggttgctttatgt
ggttcaagaaaggaaactgtggataaagcattagaagaattaaattatattaatcctaat
tatgatgcaattggattttatcctaacttattagatagtaatgaagtaaaagaaatggta
gataaggttttagaaaaatggggaactatagatatacttataaataatgcaggagttagt
gataataagtcaatatatacccaaagtgatgaggatttttcaaagataattgatattaat
gtgaaggctatctttaattgcaccaaagcagtttcagaaataatgaaaaataaaaaatat
ggagtaattttaaatactagctctgttgtaagtttatatggacaaaaaacaggagtagga
tatcctacatctaagtttgcagtaaatggattaacaaagtctttagcaagggaacttgga
agggatggaataagagtaaatgctgtagcccctggaattattgctacagatatggttgcc
gctttagataagaaattagtagatcaaatagctcaaaatgtacctttaggaagagttgga
gagccagaagacatagcaaatgctttcttattcctagcctctgatatggcaagttatata
agtggagaaatattatctgtagatggttctgtagtgctttga

DBGET integrated database retrieval system