KEGG   Clostridium perfringens SM101: CPR_0992Help
Entry
CPR_0992          CDS       T00379                                 

Definition
(GenBank) lysine-N-methylase, homolog
  KO
K18475  lysine-N-methylase [EC:2.1.1.-]
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cpr02035]
    CPR_0992
Enzymes [BR:cpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     CPR_0992
Bacterial motility proteins [BR:cpr02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    CPR_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CxxCxxCC
Motif
Other DBs
NCBI-ProteinID: ABG87012
UniProt: Q0SU92
Position
complement(1132474..1133628)
Genome map
AA seq 384 aa AA seqDB search
MKTNFFIPKYMKTFKCIGPNCTDTCCAGWDINIDENTFKKYENDKGNLKELINGKYIKNS
ESDDSFNYGFMKITEDNKCPFLNENLLCEIHGKCGEENLSITCRRYPRVFNIIDDIYEKS
GLPSCEEICSKAFLNKEKMEFIEIEEELPEDFLEIRRVIDTEAFIGSDNLIQYFWDIRII
SINIMQNRNFSIEERLSLLKAFYKSLEDLKTEENFYEIEDLLEKITEYPSNITQFIDSKK
IIPLSITNNFFKIILDENLLRKVIGTRLKNLLSDLNKDQNLFNNIHKYDLKSFDTYFKKY
SYIFENYLVNQIFKDIIPFNTGGNLNESIHKLINTYKLIKSYLILWNISSQNEISEKNII
YVIQALSKDLEHNKVFKDILSYNI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaaatttttttattccaaaatatatgaagacatttaaatgcataggtcctaat
tgcactgatacttgttgtgctggttgggacattaacatagatgaaaatacctttaaaaag
tatgaaaatgataaaggaaatctaaaagaattaataaatggaaaatacataaaaaattct
gaatcagatgattcatttaattatggatttatgaaaataacagaagataataaatgcccc
tttttaaatgaaaacttactttgtgaaattcacggtaaatgtggtgaagaaaacttatct
ataacctgtagaagatatcctagagtttttaatattatagatgatatatatgagaaaagc
ggacttccttcctgtgaagaaatttgttctaaagcttttttaaataaagaaaaaatggaa
tttatagaaatagaagaagaacttcctgaagatttcctagaaatacgcagagtaatagat
actgaagcttttataggttcagataatttaattcaatatttttgggatataagaattata
tcaataaatattatgcaaaacagaaatttctctattgaggagagactaagtctattaaaa
gccttttataaaagtctagaagatctaaaaactgaagaaaacttttatgaaattgaagat
ttacttgaaaaaataactgaatatccatcaaatataacccaatttattgattctaaaaaa
attattccacttagtattaccaataacttttttaagattatcttagatgaaaatctttta
agaaaagtcattggtactaggctaaagaatttgttatcagatttaaataaggatcaaaat
ttatttaacaatatacataaatatgacttaaaatcctttgatacttactttaagaagtac
tcatacatatttgaaaattacttagtaaatcaaatttttaaggatataattccctttaat
acaggtggtaatttaaatgaaagtattcataaacttataaatacttataaactaataaaa
agctatttaatactttggaacatctcatcacaaaatgaaatttcagaaaaaaatataata
tatgtaattcaagctttaagtaaggatctagaacataataaagtatttaaagatattcta
agttataatatttaa

DBGET integrated database retrieval system