KEGG   Clostridium perfringens SM101: CPR_0993Help
Entry
CPR_0993          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06889  uncharacterized protein
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CPR_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S15 Peptidase_S9 Abhydrolase_6 DLH AXE1 FSH1 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ABG87642
UniProt: Q0SU91
Position
1133867..1134880
Genome map
AA seq 337 aa AA seqDB search
MNKVYLKQKDQTGKRSSKLKKWICGILVAIIICIILALGFGGNYLYNLAIDPDTPKDIVF
ESTESSKDVVTINSTSGPVSISSEEWLLKEIGYEDLYMTSRDGLKLHNYLIKKPNSNKWV
ITVHGYTSQGKLTSYYAKNFSDMGYNVIIPDLRGHGTSEGDYIGMGWDERLDIIDLINYI
IKEDKEAEIVLYGISMGAATVLNTSGEELPENVKALVADCGYTSAWDEFSYQLNKLFGLP
AFPMMHIANLITKIRAGYWINESSPIDQTAKSKTPTLFIQGDEDTFVPSFMVEELFNASS
AEKEKLIIKGAGHAKASKVNPKLYWETIDGFLNKYVS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtatatttaaaacaaaaagatcaaacgggtaaaagatcgagtaagcttaaa
aaatggatttgtggaatattagtagcaataataatatgtattattttagctttaggattt
ggaggaaactatttatataatttagctatagatcccgatacaccaaaggatatagtcttt
gaatcaactgaaagtagtaaagatgtggttacaataaatagtacaagtggaccagtaagt
atttcaagtgaagaatggcttttaaaggaaattggttatgaagatttatatatgacttca
agagatgggctaaaattacacaattatcttataaaaaaaccaaactctaataagtgggtt
attacagtacatggctatacatctcaaggaaaattaacatcatactatgcaaaaaacttt
tctgacatgggatataatgttataatccctgatttaagaggtcatggcactagtgaaggt
gattatataggaatgggatgggacgagcgtttagatataatagatttaattaattatata
ataaaagaagataaagaggcagagattgttttatatggtatatcaatgggggcagctaca
gttcttaatacatcaggagaagaacttccagaaaatgttaaagcccttgtagcagactgt
ggatatactagtgcatgggatgaattttcttatcagttaaataaactttttggtcttcca
gctttccctatgatgcatatagcaaatttaataacaaaaattagagctggctattggata
aatgaatcatcacctattgatcaaactgcaaaatcaaaaacaccaacattatttattcaa
ggagatgaagacacttttgttccttcctttatggtagaagaactttttaatgcctcttct
gctgaaaaggaaaaattaataataaaaggagctggacatgctaaagcaagtaaggttaat
ccaaaactttattgggaaacaatagatggttttttaaataaatatgttagttag

DBGET integrated database retrieval system