KEGG   Clostridium perfringens SM101: CPR_0994Help
Entry
CPR_0994          CDS       T00379                                 

Definition
(GenBank) DedA family protein
  KO
K03975  membrane-associated protein
Organism
cpr  Clostridium perfringens SM101
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CPR_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: ABG85491
UniProt: Q0SU90
Position
complement(1135044..1135688)
Genome map
AA seq 214 aa AA seqDB search
MNLISNFFDLILHLDKYLGVFINNYGTLTYLVLFLIILAETGLVVTPFLPGDSVIFASAT
FCALGMINIYILVPLLLIAAILGDTLNYSIGKFLGSKLLANSKLIKKEYIEKTNTYYDKY
GGKTLIIARFIPIIRTFAPFVAGIGTMKYKNFLTYNAVGGFIWVILVSSLGYFFGNIKIV
AENFSIVIIGIIVVSILPAIVGILKAKFSPKAAM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgataagtaatttttttgatctaatattacatttagataaatatctaggtgtt
tttatcaataattatggaactttgacttacttagttttatttttaataatccttgcggaa
acaggattagtagtaactccttttcttcctggagattcagtaatatttgcatcagctact
ttctgcgctttaggtatgattaatatttacatattagtaccattattattaattgcagcc
atacttggagatactttaaactatagtattggtaaatttttaggtagcaaattacttgct
aattctaagcttataaaaaaagagtatattgagaaaactaatacttattatgataaatat
ggtggaaaaaccttaataatagctagatttattcctataatccgtacctttgcacccttt
gttgcaggtataggaacaatgaagtataaaaactttttaacttacaatgcagttggtgga
tttatttgggttatacttgtatcaagtttaggatatttctttgggaatataaaaattgtt
gctgaaaatttctcaatagttattataggtataatagttgtttctatcttacctgctata
gtaggaatacttaaagctaaattctcacctaaagctgctatgtaa

DBGET integrated database retrieval system