KEGG   Clostridium perfringens SM101: CPR_1666Help
Entry
CPR_1666          CDS       T00379                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00900  Terpenoid backbone biosynthesis
cpr01100  Metabolic pathways
cpr01110  Biosynthesis of secondary metabolites
cpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPR_1666 (dxr)
Enzymes [BR:cpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CPR_1666 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 Glu_dehyd_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABG86118
UniProt: Q0SSC6
Position
complement(1862275..1863429)
Genome map
AA seq 384 aa AA seqDB search
MKRISILGVTGSIGTQTLDVLRFHKEDFELVGITANRNIELTMDIIKEFSPKYVAINHEE
SYKKLVDLVKSEGLKCEVIYGMEGLVKVATLDEIDIVVTSVVGMIGLKPTVEAIRKGKNI
ALANKETLVVAGELVMREAKENGVKILAVDSEHSAIFQSLQGNAHNKIDKILLTASGGPF
RGFTIKDLKSVTPERALKHPKWNMGQKISIDSSTLMNKGLEVIEAHWLFDCPYKDIEVVV
HPQSIIHSMVQYTDGAVIAQLGVPDMKLPIQYALNYPNREGNISEKLDLFKIRELTFEKP
DLDTFKCLKLAYEAGEKGKLMPTILNGANEVCVELFLNKKITYLQIPEIIEECMNTFDYN
KEVTLDNVINLDKEVRQYIYEKYN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaatatctatactaggggtaactggttctataggaactcaaactttagatgta
ttaagatttcataaagaagattttgaattagttggtataacagctaatagaaatatagaa
ttaacaatggatataataaaagagttttcacctaaatacgttgcaataaatcacgaggag
tcttacaaaaaacttgtagatttagtaaaaagcgaaggattaaagtgtgaagttatctat
ggtatggaaggcttagttaaagttgctactttagatgaaattgatatagttgttacttct
gttgttggtatgattggattaaaaccaactgtagaagctataagaaaaggaaaaaatatc
gctttagcaaataaagaaactttagtagtagcaggtgaacttgttatgagagaagctaaa
gaaaatggagtaaaaatacttgcggtagattcagaacatagtgctatattccaatcatta
caaggaaatgctcataacaaaattgataaaatacttttaactgcttctggagggcctttt
agaggatttactataaaagatttaaaatcagtaactccagaaagagctcttaagcatcca
aaatggaatatgggtcaaaaaatatcaatagattcatcaactctaatgaacaagggatta
gaagttatagaagctcattggttatttgattgtccttataaagatatagaggttgtagtt
catccacaatcaataatacattctatggttcaatatactgatggagcagttatagctcaa
ttaggtgtaccagatatgaaattaccaattcaatatgctttaaattatccaaatagagaa
ggaaatattagtgaaaagttagatttgtttaaaattagagagttaacttttgaaaagccg
gatttagatacatttaaatgcttaaaattagcttatgaagcaggagaaaagggaaagctt
atgccaacaatcttaaatggtgcaaatgaagtatgtgttgaactattcctaaataaaaag
ataacatatctgcaaataccagagataatagaagaatgtatgaatacttttgattacaac
aaagaggttactcttgataatgtaataaatttagataaagaagtaagacagtatatatat
gaaaaatataactag

DBGET integrated database retrieval system